BLASTX nr result
ID: Atractylodes22_contig00047340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00047340 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17575.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_004165472.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 ref|XP_004148464.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 >emb|CBI17575.3| unnamed protein product [Vitis vinifera] Length = 656 Score = 67.8 bits (164), Expect = 9e-10 Identities = 34/73 (46%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = -2 Query: 216 DSPFCYGNTVVNCFHSQTQFKRNKPIKQITRKFKK-TNKSNVDENVVNPRVYMKDAIRNI 40 D F Y + + HS QF++ KP+++ ++KF+K T K NVD ++YM+D I NI Sbjct: 80 DRAFGYWKSSIRALHSLHQFRQKKPVQRTSQKFRKPTEKENVDH-----KIYMRDTIGNI 134 Query: 39 SNILRYSTWDSAQ 1 S ILRY TWDSAQ Sbjct: 135 SKILRYLTWDSAQ 147 >ref|XP_004165472.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Cucumis sativus] Length = 737 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/67 (46%), Positives = 42/67 (62%) Frame = -2 Query: 201 YGNTVVNCFHSQTQFKRNKPIKQITRKFKKTNKSNVDENVVNPRVYMKDAIRNISNILRY 22 Y N C HS Q+KR+KPI + +R+ +K K E V+ PR+Y +D +RNI NILR Sbjct: 91 YQNISSKCLHSLHQYKRDKPISRFSRQSRKGTKVAKKEEVI-PRLYTRDTVRNICNILRN 149 Query: 21 STWDSAQ 1 +W SAQ Sbjct: 150 CSWASAQ 156 >ref|XP_004148464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Cucumis sativus] Length = 1058 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/67 (46%), Positives = 42/67 (62%) Frame = -2 Query: 201 YGNTVVNCFHSQTQFKRNKPIKQITRKFKKTNKSNVDENVVNPRVYMKDAIRNISNILRY 22 Y N C HS Q+KR+KPI + +R+ +K K E V+ PR+Y +D +RNI NILR Sbjct: 72 YQNISSKCLHSLHQYKRDKPISRFSRQSRKGTKVAKKEEVI-PRLYTRDTVRNICNILRN 130 Query: 21 STWDSAQ 1 +W SAQ Sbjct: 131 CSWASAQ 137