BLASTX nr result
ID: Atractylodes22_contig00047201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00047201 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ65869.1| putative integrase [Cucumis melo] 157 1e-36 gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 157 1e-36 emb|CAJ65876.1| putative integrase [Cucumis melo] 156 1e-36 emb|CAJ65870.1| putative integrase [Cucumis melo] 156 2e-36 emb|CAJ65868.1| putative integrase [Cucumis melo] 156 2e-36 >emb|CAJ65869.1| putative integrase [Cucumis melo] Length = 134 Score = 157 bits (396), Expect = 1e-36 Identities = 69/99 (69%), Positives = 91/99 (91%) Frame = +3 Query: 3 GLLQPLAIPQQVWEDVSMDFVEGLPLSEGYNALLVVVDRLTKYSHFIGIRHPFTAQIIAR 182 GLLQPL IP ++WED+SMDFVEGLP S+G++ +LVVVDRL+KY+HFI + HPF+A+++A Sbjct: 28 GLLQPLPIPNRIWEDISMDFVEGLPCSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL 87 Query: 183 VFVKEVVRLHGMPKSVVSDRDKVFISNFWKELWRLQGTK 299 VFVKEVVRLHG P+S+VSDRD+VF+S+FW+EL+RLQGT+ Sbjct: 88 VFVKEVVRLHGYPRSIVSDRDRVFLSHFWQELFRLQGTQ 126 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 157 bits (396), Expect = 1e-36 Identities = 69/99 (69%), Positives = 90/99 (90%) Frame = +3 Query: 3 GLLQPLAIPQQVWEDVSMDFVEGLPLSEGYNALLVVVDRLTKYSHFIGIRHPFTAQIIAR 182 GLLQPL +P ++WED+SMDF+ GLP S+GY A+LVVVDRL+KYSHFI ++HP+TA++IA Sbjct: 922 GLLQPLPVPDRIWEDLSMDFIMGLPKSKGYEAVLVVVDRLSKYSHFILLKHPYTAKVIAD 981 Query: 183 VFVKEVVRLHGMPKSVVSDRDKVFISNFWKELWRLQGTK 299 VF++EVVRLHG+P S+VSDRD +F+SNFWKEL++LQGTK Sbjct: 982 VFIREVVRLHGIPLSIVSDRDPIFMSNFWKELFKLQGTK 1020 >emb|CAJ65876.1| putative integrase [Cucumis melo] Length = 134 Score = 156 bits (395), Expect = 1e-36 Identities = 69/99 (69%), Positives = 91/99 (91%) Frame = +3 Query: 3 GLLQPLAIPQQVWEDVSMDFVEGLPLSEGYNALLVVVDRLTKYSHFIGIRHPFTAQIIAR 182 GLLQPL IP ++WED+SMDFVEGLP S+G++ +LVVVDRL+KY+HFI + HPF+A+++A Sbjct: 28 GLLQPLPIPNRIWEDISMDFVEGLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL 87 Query: 183 VFVKEVVRLHGMPKSVVSDRDKVFISNFWKELWRLQGTK 299 VFVKEVVRLHG P+S+VSDRD+VF+S+FW+EL+RLQGT+ Sbjct: 88 VFVKEVVRLHGYPRSIVSDRDRVFLSHFWQELFRLQGTQ 126 >emb|CAJ65870.1| putative integrase [Cucumis melo] Length = 134 Score = 156 bits (394), Expect = 2e-36 Identities = 68/99 (68%), Positives = 91/99 (91%) Frame = +3 Query: 3 GLLQPLAIPQQVWEDVSMDFVEGLPLSEGYNALLVVVDRLTKYSHFIGIRHPFTAQIIAR 182 GLLQPL IP ++WED+SMDFVEGLP S+G++ +LVVVDRL+KY+HFI + HPF+A+++A Sbjct: 28 GLLQPLPIPNRIWEDISMDFVEGLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL 87 Query: 183 VFVKEVVRLHGMPKSVVSDRDKVFISNFWKELWRLQGTK 299 VF+KEVVRLHG P+S+VSDRD+VF+S+FW+EL+RLQGT+ Sbjct: 88 VFIKEVVRLHGYPRSIVSDRDRVFLSHFWQELFRLQGTQ 126 >emb|CAJ65868.1| putative integrase [Cucumis melo] Length = 134 Score = 156 bits (394), Expect = 2e-36 Identities = 68/99 (68%), Positives = 92/99 (92%) Frame = +3 Query: 3 GLLQPLAIPQQVWEDVSMDFVEGLPLSEGYNALLVVVDRLTKYSHFIGIRHPFTAQIIAR 182 GLLQPL+IP ++WED+SMDFVEGLP S+G++ +LVVVDRL+KY+HFI + HPF+A+++A Sbjct: 28 GLLQPLSIPNRIWEDISMDFVEGLPRSKGFDTILVVVDRLSKYAHFITLGHPFSAKVVAL 87 Query: 183 VFVKEVVRLHGMPKSVVSDRDKVFISNFWKELWRLQGTK 299 VFVKEVVRLHG P+S+VSDRD+VF+++FW+EL+RLQGT+ Sbjct: 88 VFVKEVVRLHGYPRSIVSDRDRVFLNHFWQELFRLQGTQ 126