BLASTX nr result
ID: Atractylodes22_contig00046757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00046757 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537198.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 gb|ADE77782.1| unknown [Picea sitchensis] 65 6e-09 gb|ADE77505.1| unknown [Picea sitchensis] 65 6e-09 gb|ADE76547.1| unknown [Picea sitchensis] 62 5e-08 ref|NP_178983.1| pentatricopeptide repeat-containing protein [Ar... 62 5e-08 >ref|XP_003537198.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like [Glycine max] Length = 722 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +1 Query: 1 EEDKSGVYVLLSNILANAGHWEEAADVRKMMRSYGVVKQPGYSWIRS 141 + + VYVLLSNI A AG WEEAA++R+MMR +G +KQPG SWIR+ Sbjct: 676 DHNNPSVYVLLSNICAAAGQWEEAANLREMMREFGTIKQPGCSWIRT 722 >gb|ADE77782.1| unknown [Picea sitchensis] Length = 210 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +1 Query: 13 SGVYVLLSNILANAGHWEEAADVRKMMRSYGVVKQPGYSWI 135 +G+YVLLSNI A AG W++AA VRK+M+ GV+KQPGYSWI Sbjct: 41 AGIYVLLSNIYAAAGQWDDAAKVRKLMKDRGVMKQPGYSWI 81 >gb|ADE77505.1| unknown [Picea sitchensis] Length = 514 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +1 Query: 13 SGVYVLLSNILANAGHWEEAADVRKMMRSYGVVKQPGYSWI 135 +G+YVLLSNI A AG W++AA VRK+M+ GV+KQPGYSWI Sbjct: 345 AGIYVLLSNIYAAAGQWDDAAKVRKLMKDRGVMKQPGYSWI 385 >gb|ADE76547.1| unknown [Picea sitchensis] Length = 210 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/54 (53%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +1 Query: 7 DKSGVYVLLSNILANAGHWEEAADVRKMMRSYGVVKQPGYSWIRS*N--HTSSV 162 D++G YV LSNI + AG W+EAA +R++M GV K+PGYSW++ N HT SV Sbjct: 39 DRAGTYVALSNIYSAAGRWDEAAKLRRLMNDRGVKKEPGYSWVQVKNMVHTFSV 92 >ref|NP_178983.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206168|sp|Q9SIT7.1|PP151_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13600 gi|4558664|gb|AAD22682.1| hypothetical protein [Arabidopsis thaliana] gi|330251150|gb|AEC06244.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 697 Score = 62.0 bits (149), Expect = 5e-08 Identities = 34/67 (50%), Positives = 39/67 (58%), Gaps = 2/67 (2%) Frame = +1 Query: 1 EEDKSGVYVLLSNILANAGHWEEAADVRKMMRSYGVVKQPGYSWIR--S*NHTSSVAGKE 174 E SG YVLLSN+ A G WE+ +VRK MR GV KQPG SWI+ +H V K Sbjct: 591 EPSNSGPYVLLSNMYAELGKWEDVMNVRKSMRKEGVTKQPGCSWIKIQGHDHVFMVKDKS 650 Query: 175 VTRKVQI 195 RK QI Sbjct: 651 HPRKKQI 657