BLASTX nr result
ID: Atractylodes22_contig00046753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00046753 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516985.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 >ref|XP_002516985.1| conserved hypothetical protein [Ricinus communis] gi|223544073|gb|EEF45599.1| conserved hypothetical protein [Ricinus communis] Length = 274 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = -3 Query: 468 PLQYSHHNHSLSPRQY-TSHSRLEPSPIHTYYSKLEPPEYVHYNDDDHSNNMNGDITSAF 292 P+ +H ++ P Y T + + P HT YS+++ HY+DD H N+ NG+ITS F Sbjct: 209 PVYVTHSYNTYRPSPYVTEYEYIRSPPRHTTYSRMD-----HYSDDYHENSRNGNITSIF 263 Query: 291 GDEDPNGCRIV 259 DE+PN CRIV Sbjct: 264 SDENPNACRIV 274