BLASTX nr result
ID: Atractylodes22_contig00046337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00046337 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524004.1| signal transducer, putative [Ricinus communi... 61 8e-08 ref|XP_002265726.2| PREDICTED: protein SCAI homolog [Vitis vinif... 60 1e-07 emb|CBI38092.3| unnamed protein product [Vitis vinifera] 60 1e-07 emb|CAN82230.1| hypothetical protein VITISV_033343 [Vitis vinifera] 60 1e-07 >ref|XP_002524004.1| signal transducer, putative [Ricinus communis] gi|223536731|gb|EEF38372.1| signal transducer, putative [Ricinus communis] Length = 761 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = -1 Query: 296 SFSQSSGIPSTGENGGFPVPSHINYSQEMADPILPPNPCKEVLYHPSITHLITV 135 SF QS+ I G+NGG P PS INY+ ++ DP LPPN K VLY PSITHL+ V Sbjct: 274 SFYQSNSI-KYGQNGG-PGPSRINYTHDITDPTLPPNSRKAVLYRPSITHLLAV 325 >ref|XP_002265726.2| PREDICTED: protein SCAI homolog [Vitis vinifera] Length = 638 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 5/59 (8%) Frame = -1 Query: 296 SFSQSSGIPSTGEN-----GGFPVPSHINYSQEMADPILPPNPCKEVLYHPSITHLITV 135 SF QS G +G G P PS INYS ++ DP LPPNP K +LY PSITH I V Sbjct: 266 SFYQSGGASLSGMGTKIGQNGSPGPSRINYSHDITDPTLPPNPRKAILYRPSITHFIAV 324 >emb|CBI38092.3| unnamed protein product [Vitis vinifera] Length = 640 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 5/59 (8%) Frame = -1 Query: 296 SFSQSSGIPSTGEN-----GGFPVPSHINYSQEMADPILPPNPCKEVLYHPSITHLITV 135 SF QS G +G G P PS INYS ++ DP LPPNP K +LY PSITH I V Sbjct: 266 SFYQSGGASLSGMGTKIGQNGSPGPSRINYSHDITDPTLPPNPRKAILYRPSITHFIAV 324 >emb|CAN82230.1| hypothetical protein VITISV_033343 [Vitis vinifera] Length = 441 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 5/59 (8%) Frame = -1 Query: 296 SFSQSSGIPSTGEN-----GGFPVPSHINYSQEMADPILPPNPCKEVLYHPSITHLITV 135 SF QS G +G G P PS INYS ++ DP LPPNP K +LY PSITH I V Sbjct: 266 SFYQSGGASLSGMGTKIGQNGSPGPSRINYSHDITDPTLPPNPRKAILYRPSITHFIAV 324