BLASTX nr result
ID: Atractylodes22_contig00046305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00046305 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521484.1| acetylglucosaminyltransferase, putative [Ric... 65 6e-09 ref|XP_002312671.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 emb|CAI70376.1| beta 1,4 N-acetylglucosaminyltransferase [Populu... 64 1e-08 ref|XP_003555004.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-... 64 2e-08 ref|XP_002530035.1| acetylglucosaminyltransferase, putative [Ric... 63 2e-08 >ref|XP_002521484.1| acetylglucosaminyltransferase, putative [Ricinus communis] gi|223539383|gb|EEF40974.1| acetylglucosaminyltransferase, putative [Ricinus communis] Length = 387 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 316 PHSYSAVHLPAYLLNHADKYRYLLPGNCIREAG 218 PHSYSAVHLP++LLN+ADKYRYLLPGNC RE G Sbjct: 355 PHSYSAVHLPSHLLNNADKYRYLLPGNCQRERG 387 >ref|XP_002312671.1| predicted protein [Populus trichocarpa] gi|222852491|gb|EEE90038.1| predicted protein [Populus trichocarpa] Length = 388 Score = 64.7 bits (156), Expect = 8e-09 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 316 PHSYSAVHLPAYLLNHADKYRYLLPGNCIREAG 218 PHSYSAVHLP+YLL +ADKY++LLPGNC+RE+G Sbjct: 356 PHSYSAVHLPSYLLENADKYKFLLPGNCLRESG 388 >emb|CAI70376.1| beta 1,4 N-acetylglucosaminyltransferase [Populus tremula x Populus alba] Length = 388 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 316 PHSYSAVHLPAYLLNHADKYRYLLPGNCIREAG 218 PHSYSAVHLP+YLL ADKY++LLPGNC+RE+G Sbjct: 356 PHSYSAVHLPSYLLEKADKYKFLLPGNCLRESG 388 >ref|XP_003555004.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like [Glycine max] Length = 383 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 316 PHSYSAVHLPAYLLNHADKYRYLLPGNCIREAG 218 PHSYSAVHLP+YLLN+A+KY++LLPGNC RE+G Sbjct: 351 PHSYSAVHLPSYLLNNAEKYKFLLPGNCRRESG 383 >ref|XP_002530035.1| acetylglucosaminyltransferase, putative [Ricinus communis] gi|223530451|gb|EEF32335.1| acetylglucosaminyltransferase, putative [Ricinus communis] Length = 478 Score = 63.2 bits (152), Expect = 2e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -3 Query: 316 PHSYSAVHLPAYLLNHADKYRYLLPGNCIREAG 218 PHSYSAVHLP+YL+ +AD+YR+LLPGNC+RE+G Sbjct: 335 PHSYSAVHLPSYLIENADEYRFLLPGNCMRESG 367