BLASTX nr result
ID: Atractylodes22_contig00046179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00046179 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298324.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_003518298.1| PREDICTED: peptide transporter PTR1-like [Gl... 72 6e-11 ref|XP_002520427.1| peptide transporter, putative [Ricinus commu... 72 6e-11 gb|ACJ85720.1| unknown [Medicago truncatula] 71 8e-11 ref|XP_002274041.2| PREDICTED: peptide transporter PTR1-like [Vi... 70 2e-10 >ref|XP_002298324.1| predicted protein [Populus trichocarpa] gi|222845582|gb|EEE83129.1| predicted protein [Populus trichocarpa] Length = 570 Score = 73.6 bits (179), Expect = 2e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 108 EEDVYTKDGTVDYKNNPANKNTTGTWKACPYILGNE 1 EEDVYTKDGTVDY+ NPANK TGTW+ACPYI+GNE Sbjct: 3 EEDVYTKDGTVDYRGNPANKKETGTWRACPYIIGNE 38 >ref|XP_003518298.1| PREDICTED: peptide transporter PTR1-like [Glycine max] Length = 573 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 108 EEDVYTKDGTVDYKNNPANKNTTGTWKACPYILGNE 1 EEDVYTKDGTVDY+ N ANKN TGTW+ACP+ILGNE Sbjct: 3 EEDVYTKDGTVDYRGNRANKNETGTWRACPFILGNE 38 >ref|XP_002520427.1| peptide transporter, putative [Ricinus communis] gi|223540269|gb|EEF41840.1| peptide transporter, putative [Ricinus communis] Length = 571 Score = 71.6 bits (174), Expect = 6e-11 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 111 EEEDVYTKDGTVDYKNNPANKNTTGTWKACPYILGNE 1 EEED+YTKDGTVDY+ NPA+K TGTW+ACP+I+GNE Sbjct: 2 EEEDIYTKDGTVDYRGNPASKKKTGTWRACPFIIGNE 38 >gb|ACJ85720.1| unknown [Medicago truncatula] Length = 517 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 111 EEEDVYTKDGTVDYKNNPANKNTTGTWKACPYILGNE 1 EEE+VYTKDGTVDY NPAN+ TGTWKACP+ILGNE Sbjct: 2 EEENVYTKDGTVDYLGNPANRKKTGTWKACPFILGNE 38 >ref|XP_002274041.2| PREDICTED: peptide transporter PTR1-like [Vitis vinifera] Length = 1120 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 108 EEDVYTKDGTVDYKNNPANKNTTGTWKACPYILGNE 1 EED+YTKDGT+D+++NPA K TGTWKACPYILGNE Sbjct: 3 EEDIYTKDGTIDFRSNPAVKKETGTWKACPYILGNE 38 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -1 Query: 117 TEEEEDVYTKDGTVDYKNNPANKNTTGTWKACPYILGNE 1 T E+D+YTKDGT++ N PANK TG WKAC +ILGNE Sbjct: 552 TMAEDDMYTKDGTMNIHNKPANKKKTGQWKACRFILGNE 590