BLASTX nr result
ID: Atractylodes22_contig00046102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00046102 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA63753.1| cyclin A-like protein [Nicotiana tabacum] 55 6e-06 >emb|CAA63753.1| cyclin A-like protein [Nicotiana tabacum] Length = 314 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +2 Query: 32 MADQENSCGVRVTRLAKKRAMEAIGSQLQPANKKRVVLGELSN 160 MADQEN VRVTRLAKKRA EA+ LQ NKKRVVLGE+ N Sbjct: 1 MADQENC--VRVTRLAKKRAAEAMVQHLQQPNKKRVVLGEIRN 41