BLASTX nr result
ID: Atractylodes22_contig00045949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045949 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535903.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 95 7e-18 gb|ACU23624.1| unknown [Glycine max] 95 7e-18 ref|XP_004149391.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 92 6e-17 ref|XP_004162178.1| PREDICTED: zinc finger AN1 and C2H2 domain-c... 92 6e-17 sp|Q0D5B9.2|SAP16_ORYSJ RecName: Full=Zinc finger AN1 and C2H2 d... 87 1e-15 >ref|XP_003535903.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 16-like [Glycine max] Length = 278 Score = 94.7 bits (234), Expect = 7e-18 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -1 Query: 143 MGTPAFPNLGKHCSVDGCKLLDFLPFTCDCCNKVFCLEHRSYNAHQC 3 MGTP FP+LGKHC+V CKL+DFLPFTCDCC++V+CL+HRSYN HQC Sbjct: 1 MGTPEFPDLGKHCAVSDCKLIDFLPFTCDCCDQVYCLDHRSYNKHQC 47 >gb|ACU23624.1| unknown [Glycine max] Length = 278 Score = 94.7 bits (234), Expect = 7e-18 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -1 Query: 143 MGTPAFPNLGKHCSVDGCKLLDFLPFTCDCCNKVFCLEHRSYNAHQC 3 MGTP FP+LGKHC+V CKL+DFLPFTCDCC++V+CL+HRSYN HQC Sbjct: 1 MGTPEFPDLGKHCAVSDCKLIDFLPFTCDCCDQVYCLDHRSYNKHQC 47 >ref|XP_004149391.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 11-like [Cucumis sativus] Length = 289 Score = 91.7 bits (226), Expect = 6e-17 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -1 Query: 143 MGTPAFPNLGKHCSVDGCKLLDFLPFTCDCCNKVFCLEHRSYNAHQC 3 MGTP FPNLGKHC+ CK +DFLPFTCDCC++VFCLEHRSYN H C Sbjct: 1 MGTPEFPNLGKHCNFAECKQIDFLPFTCDCCHQVFCLEHRSYNRHSC 47 >ref|XP_004162178.1| PREDICTED: zinc finger AN1 and C2H2 domain-containing stress-associated protein 11-like [Cucumis sativus] gi|56605374|emb|CAI30888.1| somatic embryogenesis zinc finger 2 [Cucumis sativus] Length = 289 Score = 91.7 bits (226), Expect = 6e-17 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -1 Query: 143 MGTPAFPNLGKHCSVDGCKLLDFLPFTCDCCNKVFCLEHRSYNAHQC 3 MGTP FPNLGKHC+ CK +DFLPFTCDCC++VFCLEHRSYN H C Sbjct: 1 MGTPEFPNLGKHCNFAECKQIDFLPFTCDCCHQVFCLEHRSYNRHSC 47 >sp|Q0D5B9.2|SAP16_ORYSJ RecName: Full=Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16; Short=OsSAP16 gi|33146779|dbj|BAC79697.1| putative arsenite inducible RNA associated protein [Oryza sativa Japonica Group] gi|218199865|gb|EEC82292.1| hypothetical protein OsI_26540 [Oryza sativa Indica Group] gi|222637307|gb|EEE67439.1| hypothetical protein OsJ_24803 [Oryza sativa Japonica Group] gi|347737153|gb|AEP20538.1| zinc finger AN1 and C2H2 domain-containing protein [Oryza sativa Japonica Group] Length = 290 Score = 87.4 bits (215), Expect = 1e-15 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -1 Query: 143 MGTPAFPNLGKHCSVDGCKLLDFLPFTCDCCNKVFCLEHRSYNAHQC 3 MGTP FPNLGKHCSV C +DFLPFTCD C+ VFCL+HRSY +HQC Sbjct: 1 MGTPEFPNLGKHCSVGDCNQIDFLPFTCDRCDHVFCLQHRSYTSHQC 47