BLASTX nr result
ID: Atractylodes22_contig00045929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045929 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531569.1| ftsj, putative [Ricinus communis] gi|2235287... 104 6e-21 ref|XP_003616417.1| Ribosomal RNA large subunit methyltransferas... 103 2e-20 ref|XP_002316277.1| predicted protein [Populus trichocarpa] gi|2... 103 2e-20 gb|ACD69681.1| methyl transferase [Mangifera indica] 102 3e-20 ref|XP_002283276.1| PREDICTED: ribosomal RNA large subunit methy... 99 3e-19 >ref|XP_002531569.1| ftsj, putative [Ricinus communis] gi|223528799|gb|EEF30805.1| ftsj, putative [Ricinus communis] Length = 228 Score = 104 bits (260), Expect = 6e-21 Identities = 49/70 (70%), Positives = 58/70 (82%) Frame = -2 Query: 300 DAAQEEKQPSQEDDVGVLQTGGHLIVKLLESEDTKELSKICKPLFRKSSWLRPKATRSNS 121 D Q + S E+D GVLQ GGHL++KLLESED +E ++ICKPLFRK+SWLRPKATRS+S Sbjct: 158 DENQNDDSTSGENDNGVLQAGGHLVIKLLESEDIQEFTRICKPLFRKASWLRPKATRSSS 217 Query: 120 REIYLICQDL 91 REIYLICQ L Sbjct: 218 REIYLICQGL 227 >ref|XP_003616417.1| Ribosomal RNA large subunit methyltransferase E [Medicago truncatula] gi|355517752|gb|AES99375.1| Ribosomal RNA large subunit methyltransferase E [Medicago truncatula] Length = 238 Score = 103 bits (256), Expect = 2e-20 Identities = 49/71 (69%), Positives = 57/71 (80%) Frame = -2 Query: 303 LDAAQEEKQPSQEDDVGVLQTGGHLIVKLLESEDTKELSKICKPLFRKSSWLRPKATRSN 124 LD +E PS DD G+L+ GGHL+VKLLESED KE+++ICKPLF KS WLRPKATR + Sbjct: 162 LDEVKERCDPSGADDGGLLRVGGHLVVKLLESEDAKEINQICKPLFTKSVWLRPKATRPS 221 Query: 123 SREIYLICQDL 91 SREIYLICQ L Sbjct: 222 SREIYLICQGL 232 >ref|XP_002316277.1| predicted protein [Populus trichocarpa] gi|222865317|gb|EEF02448.1| predicted protein [Populus trichocarpa] Length = 232 Score = 103 bits (256), Expect = 2e-20 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = -2 Query: 264 DDVGVLQTGGHLIVKLLESEDTKELSKICKPLFRKSSWLRPKATRSNSREIYLICQDL 91 DD G+LQ GGHL++KLLESED KE S+ICKPLFRK+SWLRPKATRS+SREIYLICQ L Sbjct: 173 DDNGILQPGGHLVIKLLESEDNKEFSRICKPLFRKASWLRPKATRSSSREIYLICQGL 230 >gb|ACD69681.1| methyl transferase [Mangifera indica] Length = 115 Score = 102 bits (254), Expect = 3e-20 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = -2 Query: 273 SQEDDVGVLQTGGHLIVKLLESEDTKELSKICKPLFRKSSWLRPKATRSNSREIYLICQD 94 S D+ GVL+ GGHL++KLLESED KE S+ICKPLFRK+SWLRPKATRS+SREIYLICQD Sbjct: 56 SDPDENGVLKPGGHLVIKLLESEDVKEFSQICKPLFRKASWLRPKATRSSSREIYLICQD 115 >ref|XP_002283276.1| PREDICTED: ribosomal RNA large subunit methyltransferase E [Vitis vinifera] gi|296086215|emb|CBI31656.3| unnamed protein product [Vitis vinifera] Length = 233 Score = 99.4 bits (246), Expect = 3e-19 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = -2 Query: 273 SQEDDVGVLQTGGHLIVKLLESEDTKELSKICKPLFRKSSWLRPKATRSNSREIYLICQD 94 S DD G+LQ GGHL++KLLESED + S+ICKPLFRK+SWLRPKATRS+SREIYLICQ Sbjct: 171 SGPDDDGILQPGGHLVIKLLESEDAQGFSRICKPLFRKASWLRPKATRSSSREIYLICQG 230 Query: 93 L 91 L Sbjct: 231 L 231