BLASTX nr result
ID: Atractylodes22_contig00045809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045809 (405 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51258.1|AC025782_3 Ty1/copia-element polyprotein [Arabidop... 54 2e-07 >gb|AAG51258.1|AC025782_3 Ty1/copia-element polyprotein [Arabidopsis thaliana] Length = 1152 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = -1 Query: 258 CSHCHKSGHDDTTCFELHGTPEWFIEKYGSKGTTKG 151 C+HC +S H TCF+LHG PEW+ EKYG + +G Sbjct: 275 CTHCGRSNHSADTCFKLHGVPEWYTEKYGDTSSGRG 310 Score = 25.8 bits (55), Expect(2) = 2e-07 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -2 Query: 395 QTIAQEEHVWGIVRFKDEAPEAIGFAI 315 + IA+E H+ I R K+E +A+GFA+ Sbjct: 231 EIIAEERHLT-ITRSKEERVDAVGFAV 256