BLASTX nr result
ID: Atractylodes22_contig00045709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045709 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520700.1| RNA binding protein, putative [Ricinus commu... 59 4e-07 >ref|XP_002520700.1| RNA binding protein, putative [Ricinus communis] gi|223540085|gb|EEF41662.1| RNA binding protein, putative [Ricinus communis] Length = 436 Score = 58.9 bits (141), Expect = 4e-07 Identities = 39/91 (42%), Positives = 49/91 (53%), Gaps = 14/91 (15%) Frame = -1 Query: 304 TYGLMQYCLPLVQNHPPFAN--PTPNQENALQVG---------SPRDYAVPRARYMGPAF 158 TYGLM Y LP +Q+ P F + P NQ NAL+ G PR+YA+P A Y+G A+ Sbjct: 234 TYGLMPYRLPPLQSQPAFHSIIPPVNQGNALRGGVRPDLGPSMGPRNYALPPASYVGSAY 293 Query: 157 PVAPRGEYP---PGDLWGMRSFSCPSSPAPV 74 P P +YP PG + R S SSP V Sbjct: 294 PAVPGIQYPMAYPGGMMSPRPLS--SSPGAV 322