BLASTX nr result
ID: Atractylodes22_contig00045382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045382 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514905.1| LIGULELESS1 protein, putative [Ricinus commu... 57 1e-06 >ref|XP_002514905.1| LIGULELESS1 protein, putative [Ricinus communis] gi|223545956|gb|EEF47459.1| LIGULELESS1 protein, putative [Ricinus communis] Length = 483 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/66 (45%), Positives = 42/66 (63%) Frame = +2 Query: 38 HSDNPSSILQHGIQSVPQGLPLSSSDYWQAEQQSIDPHIHGVPAKTSNAANSQFQEFQLF 217 H+ P S+L +VPQGLPL+SSDYW+AEQ + +H + ++ N ++S FQEFQL Sbjct: 416 HTGMPQSVLH----AVPQGLPLTSSDYWRAEQHITNSRVHTLTSQ--NDSSSYFQEFQLL 469 Query: 218 SRFYSN 235 Y N Sbjct: 470 RAPYDN 475