BLASTX nr result
ID: Atractylodes22_contig00045377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045377 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266606.1| PREDICTED: DUF246 domain-containing protein ... 83 2e-14 ref|XP_004161417.1| PREDICTED: DUF246 domain-containing protein ... 83 3e-14 ref|XP_004149620.1| PREDICTED: DUF246 domain-containing protein ... 83 3e-14 ref|XP_002520639.1| conserved hypothetical protein [Ricinus comm... 76 3e-12 ref|XP_003599015.1| Growth regulator like protein [Medicago trun... 74 2e-11 >ref|XP_002266606.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297736200|emb|CBI24838.3| unnamed protein product [Vitis vinifera] Length = 536 Score = 83.2 bits (204), Expect = 2e-14 Identities = 41/71 (57%), Positives = 54/71 (76%), Gaps = 1/71 (1%) Frame = -1 Query: 212 CGITP-QKVTSTSILNGVSNSQLKDEEMDEFWKQPDGFGYKPCLDFSEEYKKSSVEILKD 36 CGIT Q + S L+ + +D E EFW+QPDG GY+PCL+FS+EYKK+S+EI++D Sbjct: 83 CGITQSQGIVSAGSLSSHLGVK-EDGEKSEFWEQPDGLGYRPCLEFSKEYKKTSLEIVED 141 Query: 35 RTKYLVVVVSG 3 RTKYL+VVVSG Sbjct: 142 RTKYLMVVVSG 152 >ref|XP_004161417.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 572 Score = 82.8 bits (203), Expect = 3e-14 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 5/69 (7%) Frame = -1 Query: 194 KVTSTSI--LNGVSNSQLKDEE---MDEFWKQPDGFGYKPCLDFSEEYKKSSVEILKDRT 30 +VTS S L +S LK +E EFWKQPDG GYKPCLDFSEEYKKS+ I+ +RT Sbjct: 121 EVTSDSFQSLRPISTGVLKSDEGNEQGEFWKQPDGLGYKPCLDFSEEYKKSTTGIVSERT 180 Query: 29 KYLVVVVSG 3 KYL+VVVSG Sbjct: 181 KYLMVVVSG 189 >ref|XP_004149620.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 556 Score = 82.8 bits (203), Expect = 3e-14 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 5/69 (7%) Frame = -1 Query: 194 KVTSTSI--LNGVSNSQLKDEE---MDEFWKQPDGFGYKPCLDFSEEYKKSSVEILKDRT 30 +VTS S L +S LK +E EFWKQPDG GYKPCLDFSEEYKKS+ I+ +RT Sbjct: 121 EVTSDSFQSLRPISTGVLKSDEGNEQGEFWKQPDGLGYKPCLDFSEEYKKSTTGIVSERT 180 Query: 29 KYLVVVVSG 3 KYL+VVVSG Sbjct: 181 KYLMVVVSG 189 >ref|XP_002520639.1| conserved hypothetical protein [Ricinus communis] gi|223540159|gb|EEF41735.1| conserved hypothetical protein [Ricinus communis] Length = 589 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -1 Query: 152 QLKDEEMDEFWKQPDGFGYKPCLDFSEEYKKSSVEILKDRTKYLVVVVSG 3 + + E EFWKQPDG GYKPCLDFS+EY++ S ++KDR KYL+VVVSG Sbjct: 157 ETSEGEESEFWKQPDGLGYKPCLDFSKEYRRGSELVVKDRRKYLIVVVSG 206 >ref|XP_003599015.1| Growth regulator like protein [Medicago truncatula] gi|355488063|gb|AES69266.1| Growth regulator like protein [Medicago truncatula] Length = 600 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = -1 Query: 164 VSNSQLKDEEMDEFWKQPDGFGYKPCLDFSEEYKKSSVEILKDRTKYLVVVVSG 3 VS+ QL+ + EFWK+P+G GYKPCL FS +Y++ S +LKDR KYL+VVVSG Sbjct: 130 VSHVQLQAKGSSEFWKKPNGLGYKPCLSFSNDYRRQSERVLKDRRKYLMVVVSG 183