BLASTX nr result
ID: Atractylodes22_contig00045284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045284 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552679.1| PREDICTED: late blight resistance protein R1... 65 6e-09 emb|CAN75534.1| hypothetical protein VITISV_009639 [Vitis vinifera] 61 8e-08 gb|AAT39951.2| Disease resistance protein, putative [Solanum dem... 61 8e-08 emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] 61 1e-07 ref|XP_003612081.1| Disease resistance RPP8-like protein [Medica... 60 1e-07 >ref|XP_003552679.1| PREDICTED: late blight resistance protein R1-A-like [Glycine max] Length = 778 Score = 65.1 bits (157), Expect = 6e-09 Identities = 38/83 (45%), Positives = 53/83 (63%), Gaps = 2/83 (2%) Frame = +1 Query: 37 TRSFLFISKEWCG-LSEETVPFLYNAFKHLQVLELGNLSTHFLPSEIGQLIHLRYLSIRT 213 TRS L KE + ++ +L+ +FK +VL+LG ++ LPS + +LIHLRYLSI + Sbjct: 445 TRSLLCFGKEEVSDVKKDQWEWLFKSFKLARVLDLGQMNVTSLPSGLKKLIHLRYLSIHS 504 Query: 214 HGL-VIPKSISVLWNLQTLVIYG 279 H L IP SI LWNL+TL + G Sbjct: 505 HNLETIPDSICNLWNLETLDLRG 527 >emb|CAN75534.1| hypothetical protein VITISV_009639 [Vitis vinifera] Length = 1061 Score = 61.2 bits (147), Expect = 8e-08 Identities = 42/98 (42%), Positives = 59/98 (60%), Gaps = 2/98 (2%) Frame = +1 Query: 1 LDYVFSKPVSPSTRSFLFISK-EWCGLSEETVPFLYNAFKHLQVLELGNLSTHFLPSEIG 177 L Y + ++P R+ LF + + C S+ + F+ FK L+VL+L L LPS IG Sbjct: 137 LRYASIEHLTPYLRTLLFFNLGKNCRASQ--LDFIAKCFKVLRVLDLEGLEIECLPSIIG 194 Query: 178 QLIHLRYLSIRTHGL-VIPKSISVLWNLQTLVIYGLNE 288 +LIHLRYL +R +GL ++P SI L +LQTL I L E Sbjct: 195 ELIHLRYLGLRHNGLKMLPPSIGNLKSLQTLDINNLKE 232 >gb|AAT39951.2| Disease resistance protein, putative [Solanum demissum] Length = 2544 Score = 61.2 bits (147), Expect = 8e-08 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 3/91 (3%) Frame = +1 Query: 19 KPVSPSTRSFLF--ISKEWCGLSEETVPFLYNAFKHLQVLELGNLSTHF-LPSEIGQLIH 189 +P S RS LF S + + F+ N+FK ++VL+L +++ + PSEI LIH Sbjct: 2190 RPHCSSIRSLLFNATSDDQYTTMARDISFILNSFKLVKVLDLESINIGYTFPSEIESLIH 2249 Query: 190 LRYLSIRTHGLVIPKSISVLWNLQTLVIYGL 282 ++Y + RT IP SI+ LWNL+T +I G+ Sbjct: 2250 MKYFAARTGADSIPSSIAKLWNLETFIIKGM 2280 >emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] Length = 902 Score = 60.8 bits (146), Expect = 1e-07 Identities = 37/91 (40%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Frame = +1 Query: 4 DYVFSKPVSPSTRSFLFISKEWCGLSEETVPFLYNAFKHLQVLELGNLSTHFLPSEIGQL 183 +Y+ + +P RS L S+ L E L+ + K L+VL+L + TH LP EI +L Sbjct: 544 EYMKLRHPNPHFRSMLHFSRCEESLRREQWKSLFESLKLLRVLDLERVQTHALPKEIREL 603 Query: 184 IHLRYLSIRTHGLV-IPKSISVLWNLQTLVI 273 +HLRYL +R GL +P S+ NLQTL I Sbjct: 604 VHLRYLGLRRTGLQRLPSSVQNFCNLQTLDI 634 >ref|XP_003612081.1| Disease resistance RPP8-like protein [Medicago truncatula] gi|355513416|gb|AES95039.1| Disease resistance RPP8-like protein [Medicago truncatula] Length = 941 Score = 60.5 bits (145), Expect = 1e-07 Identities = 43/101 (42%), Positives = 55/101 (54%), Gaps = 14/101 (13%) Frame = +1 Query: 7 YVFSKPVSPSTRSFLFISKE---------WCGLS---EETVPFLYNAFKHLQVLELGNLS 150 Y F K ++ +RS LF ++E W LS E+ + F+Y FK L+VLEL + Sbjct: 535 YDFLKHIADYSRSLLFFNREYNADIDKKVWIHLSFMQEKKLNFIYTEFKLLRVLELDGVR 594 Query: 151 THFLPSEIGQLIHLRYLSIRTHGL--VIPKSISVLWNLQTL 267 LPS IG LI LRYL +R L +P SI L NLQTL Sbjct: 595 LVSLPSTIGDLIQLRYLGLRKTNLEGKLPLSIRNLLNLQTL 635