BLASTX nr result
ID: Atractylodes22_contig00045267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045267 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138793.1| PREDICTED: zinc finger protein 511-like [Cuc... 62 4e-08 ref|XP_002509504.1| zinc finger protein, putative [Ricinus commu... 56 3e-06 ref|XP_002300111.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_004138793.1| PREDICTED: zinc finger protein 511-like [Cucumis sativus] gi|449518803|ref|XP_004166425.1| PREDICTED: zinc finger protein 511-like [Cucumis sativus] Length = 249 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 1 DGIVSGLSMLSTKDSTPSAISFGHRHTRGLTHVPRAATKK 120 DG++SG+S LST DSTPS+ISFG RHTRGLT VPRA ++ Sbjct: 198 DGLISGVSKLSTSDSTPSSISFGRRHTRGLTFVPRAVQRE 237 >ref|XP_002509504.1| zinc finger protein, putative [Ricinus communis] gi|223549403|gb|EEF50891.1| zinc finger protein, putative [Ricinus communis] Length = 253 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 1 DGIVSGLSMLSTKDSTPSAISFGHRHTRGLTHVPRA 108 DG+VS +S LST DS+PS+ISFG RH RGLT VPRA Sbjct: 205 DGLVSAVSRLSTSDSSPSSISFGRRHNRGLTFVPRA 240 >ref|XP_002300111.1| predicted protein [Populus trichocarpa] gi|222847369|gb|EEE84916.1| predicted protein [Populus trichocarpa] Length = 250 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 1 DGIVSGLSMLSTKDSTPSAISFGHRHTRGLTHVPRAATKK 120 DG+VS +S LST DS+PS+ISFG R+TRGLT VPRA ++ Sbjct: 206 DGLVSAVSKLSTSDSSPSSISFGRRNTRGLTFVPRAVQRE 245