BLASTX nr result
ID: Atractylodes22_contig00045201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045201 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521132.1| Serine/threonine-protein kinase PBS1, putati... 70 1e-10 ref|XP_002264706.1| PREDICTED: putative kinase-like protein TMKL... 70 2e-10 emb|CAN75299.1| hypothetical protein VITISV_008676 [Vitis vinifera] 70 2e-10 ref|XP_002303085.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 ref|XP_004154481.1| PREDICTED: LOW QUALITY PROTEIN: putative kin... 66 3e-09 >ref|XP_002521132.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] gi|223539701|gb|EEF41283.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] Length = 687 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 3 PSMEEVVKQLEENRPRNRSALYSPAETRSEIGTPF 107 P+M+EVVKQLEENRPRNRSALYSPAETRSE+GTPF Sbjct: 653 PAMDEVVKQLEENRPRNRSALYSPAETRSEVGTPF 687 >ref|XP_002264706.1| PREDICTED: putative kinase-like protein TMKL1-like [Vitis vinifera] Length = 668 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 3 PSMEEVVKQLEENRPRNRSALYSPAETRSEIGTPF 107 P+M+EVVKQLEENRPRNRSALYSP+ETRSEIGTPF Sbjct: 634 PTMDEVVKQLEENRPRNRSALYSPSETRSEIGTPF 668 >emb|CAN75299.1| hypothetical protein VITISV_008676 [Vitis vinifera] Length = 628 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 3 PSMEEVVKQLEENRPRNRSALYSPAETRSEIGTPF 107 P+M+EVVKQLEENRPRNRSALYSP+ETRSEIGTPF Sbjct: 594 PTMDEVVKQLEENRPRNRSALYSPSETRSEIGTPF 628 >ref|XP_002303085.1| predicted protein [Populus trichocarpa] gi|222844811|gb|EEE82358.1| predicted protein [Populus trichocarpa] Length = 678 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 PSMEEVVKQLEENRPRNRSALYSPAETRSEIGTPF 107 P+M+EVVKQLEENRPRNRSALYSP ETRSEIGTPF Sbjct: 644 PTMDEVVKQLEENRPRNRSALYSPNETRSEIGTPF 678 >ref|XP_004154481.1| PREDICTED: LOW QUALITY PROTEIN: putative kinase-like protein TMKL1-like [Cucumis sativus] Length = 729 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 PSMEEVVKQLEENRPRNRSALYSPAETRSEIGTPF 107 PS++EVVKQLEENRPRNRSALYSP ETRSE GTPF Sbjct: 695 PSIDEVVKQLEENRPRNRSALYSPTETRSENGTPF 729