BLASTX nr result
ID: Atractylodes22_contig00045192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045192 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 58 9e-07 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 151 GVVWLTKTTYEREVMALVLAVQHWRTYLLGTRFIVYTD 264 GV LTK+ YE+E+MA+VLA+QHWR YLLG RF+V TD Sbjct: 707 GVRNLTKSAYEKELMAVVLAIQHWRPYLLGRRFVVSTD 744