BLASTX nr result
ID: Atractylodes22_contig00045178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045178 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325640.1| predicted protein [Populus trichocarpa] gi|2... 102 4e-20 gb|ABA27036.1| TO65-1rc [Taraxacum officinale] 100 9e-20 ref|XP_004168970.1| PREDICTED: B3 domain-containing protein Os07... 100 1e-19 ref|XP_004137887.1| PREDICTED: B3 domain-containing protein Os07... 100 1e-19 ref|XP_003537364.1| PREDICTED: B3 domain-containing transcriptio... 100 1e-19 >ref|XP_002325640.1| predicted protein [Populus trichocarpa] gi|222862515|gb|EEF00022.1| predicted protein [Populus trichocarpa] Length = 786 Score = 102 bits (253), Expect = 4e-20 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = +3 Query: 3 PGCTCIVCIQPPSGKGKHRPNCICNVCTTVRRRFETLMLRKRKRLSEQDGETTQK 167 PGCTCIVCIQPPSGKGKH+P C CNVC TV+RRF+TLMLRK+KR SE++ ET+QK Sbjct: 631 PGCTCIVCIQPPSGKGKHKPTCTCNVCMTVKRRFKTLMLRKKKRQSEREAETSQK 685 >gb|ABA27036.1| TO65-1rc [Taraxacum officinale] Length = 106 Score = 100 bits (250), Expect = 9e-20 Identities = 43/57 (75%), Positives = 51/57 (89%) Frame = +3 Query: 3 PGCTCIVCIQPPSGKGKHRPNCICNVCTTVRRRFETLMLRKRKRLSEQDGETTQKSL 173 PGCT IVCIQPPSGKGKH+PNC CNVC TV+RRF+TLMLRK+KRLS+++ E QK+L Sbjct: 47 PGCTRIVCIQPPSGKGKHKPNCFCNVCLTVKRRFKTLMLRKKKRLSDREAEAAQKAL 103 >ref|XP_004168970.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Cucumis sativus] Length = 319 Score = 100 bits (249), Expect = 1e-19 Identities = 42/66 (63%), Positives = 55/66 (83%) Frame = +3 Query: 3 PGCTCIVCIQPPSGKGKHRPNCICNVCTTVRRRFETLMLRKRKRLSEQDGETTQKSLVPL 182 PGC+CIVCIQPPSGKGKH+P C+CNVC TV+RRF+TLM+RK+KR SE++ E QK+ + Sbjct: 119 PGCSCIVCIQPPSGKGKHKPTCMCNVCMTVKRRFKTLMMRKKKRQSEREAEIAQKNQLKW 178 Query: 183 NNETES 200 ++ ES Sbjct: 179 SSREES 184 >ref|XP_004137887.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Cucumis sativus] Length = 848 Score = 100 bits (249), Expect = 1e-19 Identities = 42/66 (63%), Positives = 55/66 (83%) Frame = +3 Query: 3 PGCTCIVCIQPPSGKGKHRPNCICNVCTTVRRRFETLMLRKRKRLSEQDGETTQKSLVPL 182 PGC+CIVCIQPPSGKGKH+P C+CNVC TV+RRF+TLM+RK+KR SE++ E QK+ + Sbjct: 648 PGCSCIVCIQPPSGKGKHKPTCMCNVCMTVKRRFKTLMMRKKKRQSEREAEIAQKNQLKW 707 Query: 183 NNETES 200 ++ ES Sbjct: 708 SSREES 713 >ref|XP_003537364.1| PREDICTED: B3 domain-containing transcription repressor VAL1-like [Glycine max] Length = 898 Score = 100 bits (249), Expect = 1e-19 Identities = 42/66 (63%), Positives = 54/66 (81%) Frame = +3 Query: 3 PGCTCIVCIQPPSGKGKHRPNCICNVCTTVRRRFETLMLRKRKRLSEQDGETTQKSLVPL 182 PGC+CIVCIQPPSGKG+H+P C CNVC TV+RRF+TLMLRK+KR SE++ +T QK L Sbjct: 699 PGCSCIVCIQPPSGKGRHKPTCTCNVCMTVKRRFKTLMLRKKKRQSEREADTAQKDQTLL 758 Query: 183 NNETES 200 +E ++ Sbjct: 759 KDEPDT 764