BLASTX nr result
ID: Atractylodes22_contig00045168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00045168 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319806.1| predicted protein [Populus trichocarpa] gi|2... 97 1e-18 ref|XP_002279701.2| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 emb|CBI20513.3| unnamed protein product [Vitis vinifera] 94 2e-17 gb|AFK35368.1| unknown [Lotus japonicus] 87 1e-15 ref|XP_002522838.1| pentatricopeptide repeat-containing protein,... 85 7e-15 >ref|XP_002319806.1| predicted protein [Populus trichocarpa] gi|222858182|gb|EEE95729.1| predicted protein [Populus trichocarpa] Length = 784 Score = 97.1 bits (240), Expect = 1e-18 Identities = 46/66 (69%), Positives = 52/66 (78%) Frame = +1 Query: 1 LSACVNAKDLERSFSVWKEYQTAGLPYNVLSSVRMYQALLASGAHKAAKILLENIPDDDP 180 L+ACVNAKDL S VWKEYQ AGLPYNV S +RMYQALLASG H +AK++L IP DDP Sbjct: 690 LTACVNAKDLGNSLLVWKEYQAAGLPYNVTSYLRMYQALLASGGHVSAKVMLNKIPKDDP 749 Query: 181 HVCCVL 198 HV V+ Sbjct: 750 HVRIVI 755 >ref|XP_002279701.2| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Vitis vinifera] Length = 848 Score = 93.6 bits (231), Expect = 2e-17 Identities = 42/66 (63%), Positives = 51/66 (77%) Frame = +1 Query: 1 LSACVNAKDLERSFSVWKEYQTAGLPYNVLSSVRMYQALLASGAHKAAKILLENIPDDDP 180 L+ACVN KDL+ S +W+EYQTAG +NVLS +RMYQA LA G HK+A +L IP DDP Sbjct: 755 LAACVNGKDLDNSRLIWREYQTAGFTHNVLSFLRMYQACLACGDHKSAANILHKIPKDDP 814 Query: 181 HVCCVL 198 HVCCV+ Sbjct: 815 HVCCVI 820 >emb|CBI20513.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 93.6 bits (231), Expect = 2e-17 Identities = 42/66 (63%), Positives = 51/66 (77%) Frame = +1 Query: 1 LSACVNAKDLERSFSVWKEYQTAGLPYNVLSSVRMYQALLASGAHKAAKILLENIPDDDP 180 L+ACVN KDL+ S +W+EYQTAG +NVLS +RMYQA LA G HK+A +L IP DDP Sbjct: 525 LAACVNGKDLDNSRLIWREYQTAGFTHNVLSFLRMYQACLACGDHKSAANILHKIPKDDP 584 Query: 181 HVCCVL 198 HVCCV+ Sbjct: 585 HVCCVI 590 >gb|AFK35368.1| unknown [Lotus japonicus] Length = 285 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/66 (59%), Positives = 50/66 (75%) Frame = +1 Query: 1 LSACVNAKDLERSFSVWKEYQTAGLPYNVLSSVRMYQALLASGAHKAAKILLENIPDDDP 180 LSAC NA DL + +W+EY+ AG PYNVLS +RMYQALLASG H++A ++L+ IP DD Sbjct: 183 LSACANAGDLNNARLIWREYEVAGFPYNVLSYLRMYQALLASGDHRSANLMLKKIPKDDM 242 Query: 181 HVCCVL 198 VC V+ Sbjct: 243 EVCSVI 248 >ref|XP_002522838.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537922|gb|EEF39536.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 867 Score = 84.7 bits (208), Expect = 7e-15 Identities = 38/62 (61%), Positives = 47/62 (75%) Frame = +1 Query: 1 LSACVNAKDLERSFSVWKEYQTAGLPYNVLSSVRMYQALLASGAHKAAKILLENIPDDDP 180 LSAC AKDL S +WKEY AG PYNV+S +RMYQALL+SG +++AK++L I DDP Sbjct: 784 LSACAKAKDLTNSLFIWKEYHAAGYPYNVISYLRMYQALLSSGDYRSAKVILAEIQKDDP 843 Query: 181 HV 186 HV Sbjct: 844 HV 845