BLASTX nr result
ID: Atractylodes22_contig00044970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00044970 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146997.1| PREDICTED: putative pentatricopeptide repeat... 69 4e-10 ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_004171797.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_004148968.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 >ref|XP_004146997.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Cucumis sativus] Length = 481 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = -3 Query: 202 QTQLESFLTINCKTSNINLNDASHYFDYMILLHPLPPISSFNRLLNAVSKIKHHKVAILF 23 Q +L SFL NCKT NI++ A H+FD M+ HP+PPISSFNRLL ++KI H+ Sbjct: 54 QHRLSSFLR-NCKTGNIDVIQAFHFFDLMMRSHPIPPISSFNRLLGGLAKINHYSQLFSL 112 Query: 22 YRRM 11 Y +M Sbjct: 113 YNKM 116 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 66.6 bits (161), Expect = 2e-09 Identities = 40/94 (42%), Positives = 56/94 (59%), Gaps = 11/94 (11%) Frame = -3 Query: 256 LSSLLQ---QSIQKAPPSIPKQT--------QLESFLTINCKTSNINLNDASHYFDYMIL 110 LSSL + + I P S+ K T QLE+FL NCK+ +I ++A F+++I Sbjct: 26 LSSLFEHPHRPISPGPISLTKDTVSNAPDRGQLENFLKSNCKSGHIKRSEAFSVFNHLID 85 Query: 109 LHPLPPISSFNRLLNAVSKIKHHKVAILFYRRMN 8 + P PPISSFN LL AV+KIK + I Y+RM+ Sbjct: 86 MQPTPPISSFNTLLGAVAKIKRYFDVISLYKRMS 119 >ref|XP_004171797.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 618 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = -3 Query: 172 NCKTSNINLNDASHYFDYMILLHPLPPISSFNRLLNAVSKIKHHKVAILFYRRM 11 NCKT NI A H+FD M+ HP+PPISSFNRLL ++KI H+ Y M Sbjct: 64 NCKTGNITAIQAFHFFDLMMRSHPIPPISSFNRLLGGLAKINHYSQLFSLYNEM 117 >ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 605 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/88 (36%), Positives = 45/88 (51%) Frame = -3 Query: 265 SGNLSSLLQQSIQKAPPSIPKQTQLESFLTINCKTSNINLNDASHYFDYMILLHPLPPIS 86 + NLSSL S +IP +F +CKT N+ A H+F M+ P P +S Sbjct: 16 NSNLSSLFTHS-----SAIPSPNPQIAFFLRHCKTGNVTATHALHFFHLMMRSTPTPSLS 70 Query: 85 SFNRLLNAVSKIKHHKVAILFYRRMNKS 2 SFN LL+ ++KIKH+ Y +M S Sbjct: 71 SFNHLLSGLAKIKHYSQVFSLYNQMRLS 98 >ref|XP_004148968.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 580 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/88 (36%), Positives = 45/88 (51%) Frame = -3 Query: 265 SGNLSSLLQQSIQKAPPSIPKQTQLESFLTINCKTSNINLNDASHYFDYMILLHPLPPIS 86 + NLSSL S +IP +F +CKT N+ A H+F M+ P P +S Sbjct: 16 NSNLSSLFTHS-----SAIPSPNPQIAFFLRHCKTGNVTATHALHFFHLMMRSTPTPSLS 70 Query: 85 SFNRLLNAVSKIKHHKVAILFYRRMNKS 2 SFN LL+ ++KIKH+ Y +M S Sbjct: 71 SFNHLLSGLAKIKHYSQVFSLYNQMRLS 98