BLASTX nr result
ID: Atractylodes22_contig00044921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00044921 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319825.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002317585.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_002522995.1| hypothetical protein RCOM_0586940 [Ricinus c... 68 7e-10 ref|XP_003553107.1| PREDICTED: uncharacterized protein LOC100777... 63 3e-08 ref|XP_002278776.1| PREDICTED: uncharacterized protein LOC100243... 63 3e-08 >ref|XP_002319825.1| predicted protein [Populus trichocarpa] gi|222858201|gb|EEE95748.1| predicted protein [Populus trichocarpa] Length = 166 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -3 Query: 380 NRRKTDKKGSCMVEIVDIKCGVPDKTWVNPITNRFKKLSFSKLSET 243 +R K+DKK + +VEIVDIKCG PD+ W NPITN+ KKL FSKLSE+ Sbjct: 119 SREKSDKKATHIVEIVDIKCGNPDRAWANPITNKLKKLGFSKLSES 164 >ref|XP_002317585.1| predicted protein [Populus trichocarpa] gi|222860650|gb|EEE98197.1| predicted protein [Populus trichocarpa] Length = 162 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = -3 Query: 380 NRRKTDKKGSCMVEIVDIKCGVPDKTWVNPITNRFKKLSFSKLSET 243 +R K+DKK + +VEIVDI+CG PD+TW NPIT++ KKL FSKLSE+ Sbjct: 115 SREKSDKKATKIVEIVDIRCGSPDRTWANPITSKLKKLGFSKLSES 160 >ref|XP_002522995.1| hypothetical protein RCOM_0586940 [Ricinus communis] gi|223537807|gb|EEF39425.1| hypothetical protein RCOM_0586940 [Ricinus communis] Length = 165 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 380 NRRKTDKKGSCMVEIVDIKCGVPDKTWVNPITNRFKKLSFSKLSET 243 +R KT+KKG +VE+VDIKCG PDK W +PIT++ KKL FSKLSE+ Sbjct: 118 SREKTNKKGPNIVEVVDIKCGHPDKAWASPITSKLKKLGFSKLSES 163 >ref|XP_003553107.1| PREDICTED: uncharacterized protein LOC100777222 [Glycine max] Length = 162 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -3 Query: 377 RRKTDKKGSCMVEIVDIKCGVPDKTWVNPITNRFKKLSFSKLSET 243 ++K KK S +VE+VDIKCG DKTW PITN KKL FSKLSE+ Sbjct: 116 KKKDKKKKSKIVEVVDIKCGYVDKTWATPITNSLKKLGFSKLSES 160 >ref|XP_002278776.1| PREDICTED: uncharacterized protein LOC100243568 [Vitis vinifera] Length = 161 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 377 RRKTDKKGSCMVEIVDIKCGVPDKTWVNPITNRFKKLSFSKLSET 243 R+K +KKGS VEIVDIKCG D+ W +PITNR KKL FSKLSE+ Sbjct: 117 RQKAEKKGS--VEIVDIKCGNTDRAWSSPITNRLKKLGFSKLSES 159