BLASTX nr result
ID: Atractylodes22_contig00044537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00044537 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68680.1| hypothetical protein VITISV_041943 [Vitis vinifera] 61 1e-07 >emb|CAN68680.1| hypothetical protein VITISV_041943 [Vitis vinifera] Length = 124 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/55 (54%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -3 Query: 171 PCFSMRFYGPRCPQRKKLMAARSMFFLNPNPNSPTSDGPEP-VIDAFTNGYLVAH 10 PCF+ R YGPRC QRKKL+AA+S+F + +P SP S+ P+ V+D F LVAH Sbjct: 70 PCFAGRNYGPRCLQRKKLVAAKSVFLKSSSPASPMSESPDSVVVDLFGPEILVAH 124