BLASTX nr result
ID: Atractylodes22_contig00043963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043963 (502 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527372.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_003634422.1| PREDICTED: uncharacterized protein LOC100852... 57 2e-06 emb|CBI19283.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_002527372.1| conserved hypothetical protein [Ricinus communis] gi|223533291|gb|EEF35044.1| conserved hypothetical protein [Ricinus communis] Length = 3206 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/52 (59%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -3 Query: 155 MNIVKGVAGLIRRTSGY-GGEYGVGSPSHRFPVPVPKFKFSDIGDEAILSSL 3 MNIVKGVA LIRRTS GE GS + RFP P P+ +FS+ GDEA+L +L Sbjct: 1 MNIVKGVADLIRRTSSIQSGESTSGSSADRFPPPAPRIRFSEAGDEAVLHAL 52 >ref|XP_003634422.1| PREDICTED: uncharacterized protein LOC100852766 [Vitis vinifera] Length = 544 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 155 MNIVKGVAGLIRRTSG-YGGEYGVGSPSHRFPVPVPKFKFSDIGDEAILSSL 3 MNIVKGVA LIRRTSG GE G +F P PK +FS++GDEAIL +L Sbjct: 1 MNIVKGVADLIRRTSGGQTGESTSGPQVEKFSAPSPKIRFSEVGDEAILCTL 52 >emb|CBI19283.3| unnamed protein product [Vitis vinifera] Length = 3077 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 155 MNIVKGVAGLIRRTSG-YGGEYGVGSPSHRFPVPVPKFKFSDIGDEAILSSL 3 MNIVKGVA LIRRTSG GE G +F P PK +FS++GDEAIL +L Sbjct: 1 MNIVKGVADLIRRTSGGQTGESTSGPQVEKFSAPSPKIRFSEVGDEAILCTL 52