BLASTX nr result
ID: Atractylodes22_contig00043961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043961 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276556.1| PREDICTED: pentatricopeptide repeat-containi... 135 3e-30 ref|XP_004147489.1| PREDICTED: pentatricopeptide repeat-containi... 132 3e-29 ref|NP_198814.1| pentatricopeptide repeat-containing protein [Ar... 123 1e-26 ref|XP_002870737.1| pentatricopeptide repeat-containing protein ... 122 2e-26 ref|XP_002517447.1| pentatricopeptide repeat-containing protein,... 108 3e-22 >ref|XP_002276556.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Vitis vinifera] gi|296087770|emb|CBI35026.3| unnamed protein product [Vitis vinifera] Length = 675 Score = 135 bits (340), Expect = 3e-30 Identities = 70/123 (56%), Positives = 91/123 (73%), Gaps = 2/123 (1%) Frame = +2 Query: 17 PYITFNLQNFCH--RKKLRHRSIFVVISCSSTKDIWRKTPKSTTLRPSSFLQPYRRKPEV 190 P+I++ N K +HR+ F+++S KD+WR+ P TT SS Q RK V Sbjct: 26 PHISYIKTNIFSPFNKTQKHRACFILVSVF--KDVWRRLPDETTSLLSSSRQHRPRKQRV 83 Query: 191 GYLDHSIDMDELVSSINQTTNEQELFALLSPYKSRQLSIRFMVTVLSRETDWQRSLALLD 370 +LDHS+DMDEL++SI+QT+NEQEL++L+SPYK RQLSIRFMV++LSRE DWQRSLALLD Sbjct: 84 VHLDHSVDMDELLASISQTSNEQELYSLMSPYKGRQLSIRFMVSLLSREPDWQRSLALLD 143 Query: 371 WIN 379 WIN Sbjct: 144 WIN 146 >ref|XP_004147489.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Cucumis sativus] gi|449530101|ref|XP_004172035.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Cucumis sativus] Length = 680 Score = 132 bits (332), Expect = 3e-29 Identities = 72/136 (52%), Positives = 98/136 (72%), Gaps = 11/136 (8%) Frame = +2 Query: 5 TSSIPYITFNLQNF----CHRKKLRHRS---IFVVISCSSTKDIWRK-TPK---STTLRP 151 +SSIP +N+ ++ K++ R+ IF S S++KDIWR+ TP +TTL P Sbjct: 15 SSSIPLFLIETRNYPKVRFNKIKIKPRTRIPIFTASSSSTSKDIWRRQTPSEKSTTTLLP 74 Query: 152 SSFLQPYRRKPEVGYLDHSIDMDELVSSINQTTNEQELFALLSPYKSRQLSIRFMVTVLS 331 + + RR E +LDHSIDMDEL++SI QT NEQEL+++LSPYK R+LS+RFMV++LS Sbjct: 75 QKYQRSGRRPRESSHLDHSIDMDELLASIGQTKNEQELYSVLSPYKGRELSMRFMVSLLS 134 Query: 332 RETDWQRSLALLDWIN 379 RE+DWQRSLA+LDWIN Sbjct: 135 RESDWQRSLAILDWIN 150 >ref|NP_198814.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171449|sp|Q9FLD8.1|PP408_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39980, chloroplastic; Flags: Precursor gi|10176990|dbj|BAB10222.1| unnamed protein product [Arabidopsis thaliana] gi|332007115|gb|AED94498.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 678 Score = 123 bits (309), Expect = 1e-26 Identities = 64/130 (49%), Positives = 87/130 (66%), Gaps = 6/130 (4%) Frame = +2 Query: 8 SSIPYITFNLQNFCHRKKLRHRSIFVVISCSST------KDIWRKTPKSTTLRPSSFLQP 169 +SIP+ T + R R++ +S SS+ K +WRK P+ T L+ Sbjct: 25 TSIPFSTI--------PEARQRNLIFTVSASSSSESTQNKKVWRKQPEKNTTSSFQALRK 76 Query: 170 YRRKPEVGYLDHSIDMDELVSSINQTTNEQELFALLSPYKSRQLSIRFMVTVLSRETDWQ 349 +RR +LDH++DMDEL++SI+QT NE+ELF+LLS YK RQLSIRFMV++LSRE DWQ Sbjct: 77 HRRYQRSAFLDHNVDMDELLASIHQTQNEKELFSLLSTYKDRQLSIRFMVSLLSRENDWQ 136 Query: 350 RSLALLDWIN 379 RSLALLDW++ Sbjct: 137 RSLALLDWVH 146 >ref|XP_002870737.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316573|gb|EFH46996.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 680 Score = 122 bits (307), Expect = 2e-26 Identities = 61/113 (53%), Positives = 80/113 (70%), Gaps = 8/113 (7%) Frame = +2 Query: 65 RHRSIFVVISCSS--------TKDIWRKTPKSTTLRPSSFLQPYRRKPEVGYLDHSIDMD 220 R R++ +S SS TK +WRK P+ T L+ +RR +LDH++DMD Sbjct: 36 RQRNLIFKVSASSSSSSPSTQTKKVWRKQPEKNTTSSFQALRKHRRYQRSAFLDHNVDMD 95 Query: 221 ELVSSINQTTNEQELFALLSPYKSRQLSIRFMVTVLSRETDWQRSLALLDWIN 379 EL++SI+QT NE+ELF+LLS YK RQLSIRFMV++LSRE DWQRSLALLDW++ Sbjct: 96 ELLASIHQTQNEKELFSLLSTYKDRQLSIRFMVSLLSRENDWQRSLALLDWVH 148 >ref|XP_002517447.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543458|gb|EEF44989.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 654 Score = 108 bits (271), Expect = 3e-22 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 1/101 (0%) Frame = +2 Query: 80 FVVISCSSTK-DIWRKTPKSTTLRPSSFLQPYRRKPEVGYLDHSIDMDELVSSINQTTNE 256 F+++S S+TK D+W +T K+T PS YLDHS+DM +L+ SI+QT NE Sbjct: 41 FLLLSSSATKRDMWTRTQKTT---PS-------------YLDHSVDMKQLLISISQTQNE 84 Query: 257 QELFALLSPYKSRQLSIRFMVTVLSRETDWQRSLALLDWIN 379 EL++LLSPYK RQLSIRFMV+++S+E DWQRSLALLDWIN Sbjct: 85 VELYSLLSPYKERQLSIRFMVSLISQEADWQRSLALLDWIN 125