BLASTX nr result
ID: Atractylodes22_contig00043807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043807 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30188.3| unnamed protein product [Vitis vinifera] 55 4e-06 >emb|CBI30188.3| unnamed protein product [Vitis vinifera] Length = 1369 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 RYLHMSLKYAEVEAQREDLVLKLKAVGPGRSWFS 104 RY HMSLKYAEVEAQRE+LV+KLK G+ WFS Sbjct: 1336 RYFHMSLKYAEVEAQREELVMKLKVTKNGKRWFS 1369