BLASTX nr result
ID: Atractylodes22_contig00043768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043768 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599348.1| NBS-LRR type disease resistance protein [Med... 58 7e-07 >ref|XP_003599348.1| NBS-LRR type disease resistance protein [Medicago truncatula] gi|355488396|gb|AES69599.1| NBS-LRR type disease resistance protein [Medicago truncatula] Length = 1273 Score = 58.2 bits (139), Expect = 7e-07 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = -3 Query: 226 LPSTLNFLHIVGCENLD----ESWILNNFLSSLESLIIWSCDNLRSFPKDCFVHLTTLQI 59 LP++L LHIV CENL E+W +N+ S + +I SCD L SFP D F L TLQI Sbjct: 987 LPTSLQSLHIVKCENLSFLPPETW--SNYTSLVSLYLIHSCDALTSFPLDGFPVLQTLQI 1044 Query: 58 LNCDNIESI 32 NC ++ SI Sbjct: 1045 WNCRSLVSI 1053