BLASTX nr result
ID: Atractylodes22_contig00043757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043757 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67867.1| hypothetical protein VITISV_031391 [Vitis vinifera] 55 8e-06 emb|CAN66135.1| hypothetical protein VITISV_038472 [Vitis vinifera] 54 1e-05 >emb|CAN67867.1| hypothetical protein VITISV_031391 [Vitis vinifera] Length = 830 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = +1 Query: 40 CTLCDKKVCGGITRLKQHLTHTGGQVSGCPKVTPEIQKRVLESMN 174 C C K + GGITRLKQH+ H GQV GCP+V E+ V + M+ Sbjct: 24 CKYCGKVIHGGITRLKQHIAHISGQVEGCPRVPVEVSHSVRQHMS 68 >emb|CAN66135.1| hypothetical protein VITISV_038472 [Vitis vinifera] Length = 660 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = +1 Query: 40 CTLCDKKVCGGITRLKQHLTHTGGQVSGCPKVTPEIQKRVLESMN 174 C C K + GGITRLKQH+ H GQV GCP+V E+ V + M+ Sbjct: 24 CKYCGKLIHGGITRLKQHIAHISGQVEGCPRVPIEVSHSVRQHMS 68