BLASTX nr result
ID: Atractylodes22_contig00043716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043716 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ09951.2| putative gag-pol polyprotein [Citrus sinensis] 53 2e-06 >emb|CAJ09951.2| putative gag-pol polyprotein [Citrus sinensis] Length = 1334 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = -1 Query: 179 MVSVHKDDWLRAMEDEIKSLHYNHTCVLVRKPAVLR*VVINGFFKKEEGILGVESSRYK 3 M SVH D WL AM+DE++SL N T L+ P R + FK+ EGI VE +YK Sbjct: 821 MESVHCDKWLEAMQDEMESLQRNQTWTLIPNPGNKRLINCKWIFKRNEGIPDVEPPKYK 879 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 282 YVTARGSSRRQVKPRNRYGYA 220 Y AR RR+V+ RYGYA Sbjct: 776 YQLARDRVRREVRAPVRYGYA 796