BLASTX nr result
ID: Atractylodes22_contig00043714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043714 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527667.1| ring finger protein, putative [Ricinus commu... 57 2e-06 >ref|XP_002527667.1| ring finger protein, putative [Ricinus communis] gi|223532972|gb|EEF34738.1| ring finger protein, putative [Ricinus communis] Length = 383 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +2 Query: 107 MGSLKDPKTWIPQINPKDCSKKICNLYCTKWCNYII 214 M SL PKTWIP +N KDCSK C+LYC +WC YII Sbjct: 1 MASLGTPKTWIPYVNGKDCSKGFCSLYCPQWC-YII 35