BLASTX nr result
ID: Atractylodes22_contig00043649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043649 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588887.1| Pentatricopeptide repeat-containing protein ... 56 3e-06 ref|XP_003530713.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 >ref|XP_003588887.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477935|gb|AES59138.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 697 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = +1 Query: 190 MDAAQLIRLMRNVAESKSIKHAKLIHQKVITSGLHNNIAICKNLIT 327 MDA +LI L+R SKS+K K++HQKV+T GL N++ +CKNLI+ Sbjct: 1 MDARKLIPLLRASVNSKSLKQGKVLHQKVVTLGLQNDVYVCKNLIS 46 >ref|XP_003530713.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like [Glycine max] Length = 705 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +1 Query: 190 MDAAQLIRLMRNVAESKSIKHAKLIHQKVITSGLHNNIAICKNLI 324 MD +L+ L+R SKS+K KLIHQKV+T GL N+I +CKNLI Sbjct: 1 MDTRKLLPLLRACMNSKSLKQGKLIHQKVVTLGLQNDIFLCKNLI 45