BLASTX nr result
ID: Atractylodes22_contig00043535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043535 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622970.1| Pantothenate synthetase [Medicago truncatula... 63 3e-08 >ref|XP_003622970.1| Pantothenate synthetase [Medicago truncatula] gi|355497985|gb|AES79188.1| Pantothenate synthetase [Medicago truncatula] Length = 551 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/104 (29%), Positives = 51/104 (49%) Frame = +1 Query: 85 WKAIGDGTDTSFWSDRWLNEGILKETFPRLWALESVKTSTVANRIQQVEGTHRYTWDWIR 264 W+ +G+G++TSFW DRW+ + +L FPRL+ + S K V + EG R+ W R Sbjct: 126 WRGVGNGSNTSFWKDRWIGDLLLCVAFPRLFVISSQKEVKVRDVSVMQEGVRRWNLVWRR 185 Query: 265 EPRGRTGAEVXXXXXXXXXXXXXVDSKDGWSWSLDSNGLFSVKN 396 P + + +D W+W+ + G FSV++ Sbjct: 186 HP-FLWETNLISTLVASIEGITLGNDEDDWAWTPEEGGKFSVRS 228