BLASTX nr result
ID: Atractylodes22_contig00043457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043457 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276470.2| PREDICTED: uncharacterized protein At5g41620... 64 1e-08 >ref|XP_002276470.2| PREDICTED: uncharacterized protein At5g41620-like [Vitis vinifera] Length = 648 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = +2 Query: 32 KLKNGFLIGKKANKTTPSHSWKLGFH---KFSSLDPNFTMNTSVSARKIGANLWEVQ 193 KLK G L+GK+ TPS +W+LGF SS+D + +TSVSARK+GANLWE+Q Sbjct: 4 KLKRGVLVGKRGGPCTPSPTWRLGFSLNDATSSIDKDLDCSTSVSARKLGANLWEIQ 60