BLASTX nr result
ID: Atractylodes22_contig00043259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043259 (514 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516403.1| pentatricopeptide repeat-containing protein,... 110 9e-23 ref|XP_003552730.1| PREDICTED: pentatricopeptide repeat-containi... 108 5e-22 ref|XP_003538531.1| PREDICTED: pentatricopeptide repeat-containi... 99 3e-19 ref|XP_002268109.1| PREDICTED: pentatricopeptide repeat-containi... 99 4e-19 ref|NP_193155.4| pentatricopeptide repeat-containing protein [Ar... 99 5e-19 >ref|XP_002516403.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544501|gb|EEF46020.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 502 Score = 110 bits (276), Expect = 9e-23 Identities = 55/109 (50%), Positives = 75/109 (68%) Frame = +1 Query: 178 NSDKENTVQFDDRHRNWNLKRSLFEKLKAKDSDPVRILEEDGDWSKELFWAVVGFLNQTS 357 NS K NT+ + H + LK +L +L K S P+++L++D DWSK+ FWAV+ FL +S Sbjct: 53 NSIKHNTLLVESYHEHQRLK-ALLARLNKKGSCPLQMLQDDADWSKDHFWAVIRFLRHSS 111 Query: 358 RSNQVLQVFDKWTSKDDSRICEFNYERIIRFLVEEGLVEDAVLALREMK 504 RS+++LQVFD W + SRI EFNYE++I L EEGL+EDA A EMK Sbjct: 112 RSDEILQVFDMWKDIEKSRINEFNYEKVIEILGEEGLIEDAYSAFIEMK 160 >ref|XP_003552730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Glycine max] Length = 509 Score = 108 bits (270), Expect = 5e-22 Identities = 63/142 (44%), Positives = 83/142 (58%) Frame = +1 Query: 79 VFPKPSSRTLTTTKSRFSHSTNTPSVHFSRGKTNSDKENTVQFDDRHRNWNLKRSLFEKL 258 VF KP + T T T H S + K T+ + H + +L R+L KL Sbjct: 33 VFRKPFVKFRTLT---------TQICHSSYHRFADTKHTTLLVETYHLHDSL-RALLAKL 82 Query: 259 KAKDSDPVRILEEDGDWSKELFWAVVGFLNQTSRSNQVLQVFDKWTSKDDSRICEFNYER 438 + +D +P+ +L EDGDWSK+ FWAVV FL SR Q+LQVFD W + + SRI EFNY + Sbjct: 83 QKEDCNPLHVLAEDGDWSKDHFWAVVRFLKSASRFTQILQVFDMWKNIEKSRISEFNYNK 142 Query: 439 IIRFLVEEGLVEDAVLALREMK 504 II L E G +EDA+ ALR+MK Sbjct: 143 IIGLLCEGGKMEDALSALRDMK 164 >ref|XP_003538531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Glycine max] Length = 506 Score = 99.4 bits (246), Expect = 3e-19 Identities = 57/139 (41%), Positives = 80/139 (57%) Frame = +1 Query: 88 KPSSRTLTTTKSRFSHSTNTPSVHFSRGKTNSDKENTVQFDDRHRNWNLKRSLFEKLKAK 267 K SS T+ S T H S + K T+ + H + +L R+L KL+ + Sbjct: 25 KSSSNTVFRKPFAKFSSLTTKICHASYHRFADTKHTTLLVETYHLHHSL-RALLAKLENE 83 Query: 268 DSDPVRILEEDGDWSKELFWAVVGFLNQTSRSNQVLQVFDKWTSKDDSRICEFNYERIIR 447 S+P+ +L ED DWSK+ FWAVV FL +S +LQVFD W + + SRI EFNY +II Sbjct: 84 YSNPLHMLAEDADWSKDHFWAVVRFLKSSSNFTHILQVFDMWKNIEKSRISEFNYNKIIG 143 Query: 448 FLVEEGLVEDAVLALREMK 504 L E G ++DA+ AL++MK Sbjct: 144 LLCEGGKMKDALSALQDMK 162 >ref|XP_002268109.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Vitis vinifera] Length = 581 Score = 99.0 bits (245), Expect = 4e-19 Identities = 51/109 (46%), Positives = 68/109 (62%) Frame = +1 Query: 178 NSDKENTVQFDDRHRNWNLKRSLFEKLKAKDSDPVRILEEDGDWSKELFWAVVGFLNQTS 357 N K T+ + H N L L +KL K S P+++L +DGDW+K+ FWAV+ FL S Sbjct: 85 NPTKHTTLLVETLHENERLG-VLIQKLSNKASSPLQLLRDDGDWNKQHFWAVIRFLKDAS 143 Query: 358 RSNQVLQVFDKWTSKDDSRICEFNYERIIRFLVEEGLVEDAVLALREMK 504 RS+++L VF W D SRI EFNY +II L +E L E++VLAL MK Sbjct: 144 RSSEILPVFHLWKDMDKSRINEFNYAKIIGLLSQEDLAEESVLALEGMK 192 >ref|NP_193155.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635638|sp|O23278.2|PP310_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14190, chloroplastic; Flags: Precursor gi|332657991|gb|AEE83391.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 501 Score = 98.6 bits (244), Expect = 5e-19 Identities = 47/87 (54%), Positives = 62/87 (71%) Frame = +1 Query: 241 SLFEKLKAKDSDPVRILEEDGDWSKELFWAVVGFLNQTSRSNQVLQVFDKWTSKDDSRIC 420 SL +L S P+R+L+EDGDWSK+ FWAV+ FL Q+SR +++L VFD W + + SRI Sbjct: 71 SLTRRLSLSGSCPLRLLQEDGDWSKDHFWAVIRFLRQSSRLHEILPVFDTWKNLEPSRIS 130 Query: 421 EFNYERIIRFLVEEGLVEDAVLALREM 501 E NYERIIRFL EE + +A+ A R M Sbjct: 131 ENNYERIIRFLCEEKSMSEAIRAFRSM 157