BLASTX nr result
ID: Atractylodes22_contig00043182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043182 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265665.1| PREDICTED: uncharacterized protein LOC100253... 62 4e-08 ref|XP_002514640.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002265665.1| PREDICTED: uncharacterized protein LOC100253543 [Vitis vinifera] Length = 1099 Score = 62.4 bits (150), Expect = 4e-08 Identities = 38/65 (58%), Positives = 44/65 (67%) Frame = -3 Query: 196 TKMEKEAPGDVVNYRESHNVLAKLREANWYGDERRELSRSKSCQYKDGFPFSIPNDFPRF 17 TK ++ P D+ +ES VLAKLREA WY +E REL RS S + KDG SIP D PRF Sbjct: 203 TKGKQNVPVDL---KESLRVLAKLREAPWYFNEARELPRS-SYEAKDGPLPSIPKDAPRF 258 Query: 16 SYDGR 2 SYDGR Sbjct: 259 SYDGR 263 >ref|XP_002514640.1| conserved hypothetical protein [Ricinus communis] gi|223546244|gb|EEF47746.1| conserved hypothetical protein [Ricinus communis] Length = 1094 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/64 (51%), Positives = 41/64 (64%) Frame = -3 Query: 193 KMEKEAPGDVVNYRESHNVLAKLREANWYGDERRELSRSKSCQYKDGFPFSIPNDFPRFS 14 K K+ V+ +ES VLAKLREA WY +E RE +S S + KDGF ++ D PRFS Sbjct: 203 KKGKQNTNTPVDLKESLKVLAKLREAPWYYNESREKPQS-SYESKDGFSYTSCKDVPRFS 261 Query: 13 YDGR 2 YDGR Sbjct: 262 YDGR 265