BLASTX nr result
ID: Atractylodes22_contig00043031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00043031 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADV71363.1| glycosyltransferase GT03H24 [Pueraria montana var... 77 2e-12 ref|XP_003533826.1| PREDICTED: anthocyanidin 3-O-glucosyltransfe... 74 9e-12 ref|XP_002528155.1| UDP-glucosyltransferase, putative [Ricinus c... 70 2e-10 ref|XP_004161972.1| PREDICTED: putative UDP-glucose flavonoid 3-... 61 8e-08 ref|XP_004145207.1| PREDICTED: putative UDP-glucose flavonoid 3-... 61 8e-08 >gb|ADV71363.1| glycosyltransferase GT03H24 [Pueraria montana var. lobata] Length = 468 Score = 76.6 bits (187), Expect = 2e-12 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 1/80 (1%) Frame = +3 Query: 33 MKRAEVAIIATPAMGNLVPAVEFATHLINHQHRRISVAILVISMPQRPLVDDFVRSR-TS 209 M R EV IATPA+GNLVP VEFA L H R S +L I MPQRPLV+ +V++R +S Sbjct: 1 MTRYEVVFIATPALGNLVPLVEFANLLTKHD-PRFSATVLTICMPQRPLVNTYVQARASS 59 Query: 210 TDHIRFIQIHPVDPLQPDQY 269 +++ + + VDP PDQY Sbjct: 60 ATNLKLLHLPTVDPPAPDQY 79 >ref|XP_003533826.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 1-like [Glycine max] Length = 492 Score = 74.3 bits (181), Expect = 9e-12 Identities = 38/80 (47%), Positives = 54/80 (67%), Gaps = 1/80 (1%) Frame = +3 Query: 33 MKRAEVAIIATPAMGNLVPAVEFATHLINHQHRRISVAILVISMPQRPLVDDFVRSR-TS 209 M R EV IATPA+GNLVP VEFA L H + ++S +L ++ PQRPL+ +V+SR +S Sbjct: 25 MTRFEVVFIATPALGNLVPIVEFADLLTKH-NPQLSATVLTVTTPQRPLISTYVQSRASS 83 Query: 210 TDHIRFIQIHPVDPLQPDQY 269 +++ + + VDP PDQY Sbjct: 84 ATNLKLLHLPTVDPPTPDQY 103 >ref|XP_002528155.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223532453|gb|EEF34246.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 485 Score = 70.1 bits (170), Expect = 2e-10 Identities = 40/84 (47%), Positives = 54/84 (64%), Gaps = 5/84 (5%) Frame = +3 Query: 33 MKRAEVAIIATPAMGNLVPAVEFATHLINHQHRRISVAILVISMPQRPLVDDFVRSRTST 212 M++ +V I+TPA+GNLVP VEFA L +H R S +L+ISM QRP+V+ +++S ST Sbjct: 1 MRKLQVLFISTPAVGNLVPTVEFAQRLTDHD-PRFSSTVLIISMAQRPIVNAYIQSCCST 59 Query: 213 ----DHIRFIQI-HPVDPLQPDQY 269 I FI + P DP PDQY Sbjct: 60 ASSATAINFIHLPSPEDPPSPDQY 83 >ref|XP_004161972.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 3-like [Cucumis sativus] Length = 464 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 3/77 (3%) Frame = +3 Query: 48 VAIIATPAMGNLVPAVEFATHLINHQHRRISVAILVISMPQRPLVDDFVRSRTS---TDH 218 + I TPA+GNLVPAVEFA LINH R V L I +P R LV+ + +SR+S + + Sbjct: 8 LVFICTPAIGNLVPAVEFAIRLINHD-SRFFVTFLAIDIPGRSLVNAYTQSRSSLSPSPN 66 Query: 219 IRFIQIHPVDPLQPDQY 269 ++FI + + P P+ Y Sbjct: 67 LQFIHLPSLQPPSPNLY 83 >ref|XP_004145207.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 3-like [Cucumis sativus] gi|449474441|ref|XP_004154174.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 3-like [Cucumis sativus] Length = 499 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 3/77 (3%) Frame = +3 Query: 48 VAIIATPAMGNLVPAVEFATHLINHQHRRISVAILVISMPQRPLVDDFVRSRTS---TDH 218 + I TPA+GNLVPAVEFA LINH R V L I +P R LV+ + +SR+S + + Sbjct: 43 LVFICTPAIGNLVPAVEFAIRLINHD-SRFFVTFLAIDIPGRSLVNAYTQSRSSLSPSPN 101 Query: 219 IRFIQIHPVDPLQPDQY 269 ++FI + + P P+ Y Sbjct: 102 LQFIHLPSLQPPSPNLY 118