BLASTX nr result
ID: Atractylodes22_contig00042881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042881 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002334156.1| cc-nbs-lrr resistance protein [Populus trich... 59 4e-07 ref|XP_002525331.1| Disease resistance protein RGA2, putative [R... 57 2e-06 ref|XP_002302930.1| nbs-lrr resistance protein [Populus trichoca... 56 3e-06 ref|XP_003571582.1| PREDICTED: putative pleiotropic drug resista... 56 3e-06 ref|XP_003627035.1| ABC transporter family pleiotropic drug resi... 56 3e-06 >ref|XP_002334156.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222869855|gb|EEF06986.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 826 Score = 58.9 bits (141), Expect = 4e-07 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = +1 Query: 4 LTSLTIRGCETLQRRCKKEMGEDWPKISHVPHVRLE 111 L SL IRGC L++RC+K++GEDWPKI+H+PH+ ++ Sbjct: 786 LQSLIIRGCPNLKKRCEKDLGEDWPKIAHIPHISID 821 >ref|XP_002525331.1| Disease resistance protein RGA2, putative [Ricinus communis] gi|223535390|gb|EEF37064.1| Disease resistance protein RGA2, putative [Ricinus communis] Length = 1308 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = +1 Query: 4 LTSLTIRGCETLQRRCKKEMGEDWPKISHVPHVRLEDDT 120 L+SL I C +L++RCK+E GEDWPKISH+ H+ ++ DT Sbjct: 1266 LSSLIIYNCPSLKQRCKQEKGEDWPKISHIRHIEIDGDT 1304 >ref|XP_002302930.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222844656|gb|EEE82203.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 1088 Score = 56.2 bits (134), Expect = 3e-06 Identities = 20/36 (55%), Positives = 30/36 (83%) Frame = +1 Query: 4 LTSLTIRGCETLQRRCKKEMGEDWPKISHVPHVRLE 111 L SL I GC L++RC+K++GEDWPKI+H+PH+ ++ Sbjct: 1048 LQSLFISGCPNLKKRCEKDLGEDWPKIAHIPHISID 1083 >ref|XP_003571582.1| PREDICTED: putative pleiotropic drug resistance protein 7-like [Brachypodium distachyon] Length = 1450 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 218 ETTLMDVLAGRKTGGYISGDVFVSGYPKN 304 +TTLMDVLAGRKTGGYI GDV +SGYPKN Sbjct: 903 KTTLMDVLAGRKTGGYIEGDVSISGYPKN 931 >ref|XP_003627035.1| ABC transporter family pleiotropic drug resistance protein [Medicago truncatula] gi|355521057|gb|AET01511.1| ABC transporter family pleiotropic drug resistance protein [Medicago truncatula] Length = 1289 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 218 ETTLMDVLAGRKTGGYISGDVFVSGYPKN 304 +TTLMDVLAGRKTGGYI GDV +SGYPKN Sbjct: 910 KTTLMDVLAGRKTGGYIEGDVRISGYPKN 938