BLASTX nr result
ID: Atractylodes22_contig00042549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042549 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524511.1| ATP binding protein, putative [Ricinus commu... 60 2e-07 ref|XP_004162117.1| PREDICTED: probable leucine-rich repeat rece... 55 5e-06 ref|XP_004146082.1| PREDICTED: probable leucine-rich repeat rece... 55 5e-06 ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago ... 55 5e-06 ref|XP_003628428.1| Leucine-rich repeat family protein /protein ... 55 5e-06 >ref|XP_002524511.1| ATP binding protein, putative [Ricinus communis] gi|223536185|gb|EEF37838.1| ATP binding protein, putative [Ricinus communis] Length = 985 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/57 (49%), Positives = 38/57 (66%), Gaps = 5/57 (8%) Frame = +1 Query: 160 VDALRTIGESLGKIWDFEEDPCS----WVATRDDRNYENNVTCNCA-PNGTICNIVS 315 V+AL+ IG++LGK W+F DPCS W + +EN VTCNC+ N TIC++VS Sbjct: 32 VEALKDIGKTLGKTWNFTVDPCSGDSGWTTPNPVKGFENAVTCNCSFSNATICHVVS 88 >ref|XP_004162117.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Cucumis sativus] Length = 1007 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 9/61 (14%) Frame = +1 Query: 160 VDALRTIGESLGKI-WDFEEDPCS-----WVATRD--DRNYENNVTCNCA-PNGTICNIV 312 VDAL IG+ LGK W+F EDPC W++ + D N+ENNVTC+C N T+C++ Sbjct: 33 VDALEEIGKILGKTDWNFREDPCGGEASGWISESNKFDTNFENNVTCDCTFQNNTVCHVT 92 Query: 313 S 315 + Sbjct: 93 N 93 >ref|XP_004146082.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Cucumis sativus] Length = 1007 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 9/61 (14%) Frame = +1 Query: 160 VDALRTIGESLGKI-WDFEEDPCS-----WVATRD--DRNYENNVTCNCA-PNGTICNIV 312 VDAL IG+ LGK W+F EDPC W++ + D N+ENNVTC+C N T+C++ Sbjct: 33 VDALEEIGKILGKTDWNFREDPCGGEASGWISESNKFDTNFENNVTCDCTFQNNTVCHVT 92 Query: 313 S 315 + Sbjct: 93 N 93 >ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago truncatula] gi|355522454|gb|AET02908.1| hypothetical protein MTR_8g058070 [Medicago truncatula] Length = 117 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = +1 Query: 160 VDALRTIGESLGKI-WDFEEDPCS----WVATRDDRNYENNVTCNCA-PNGTICNIVS 315 V+AL+ IG++LGK WDF DPCS W+++ EN VTCNC+ N T+C++VS Sbjct: 33 VEALKDIGKTLGKKDWDFSVDPCSGRNNWISSTQLHGSENAVTCNCSFQNNTLCHVVS 90 >ref|XP_003628428.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] gi|355522450|gb|AET02904.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] Length = 116 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = +1 Query: 160 VDALRTIGESLGKI-WDFEEDPCS----WVATRDDRNYENNVTCNCA-PNGTICNIVS 315 V+AL+ IG++LGK WDF DPCS W+++ EN VTCNC+ N T+C++VS Sbjct: 33 VEALKDIGKTLGKKDWDFSVDPCSGRNNWISSTQLHGSENAVTCNCSFQNNTLCHVVS 90