BLASTX nr result
ID: Atractylodes22_contig00042519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042519 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606649.1| hypothetical protein MTR_4g063500 [Medicago ... 66 5e-09 ref|NP_973779.1| dessication-induced 1VOC-like protein [Arabidop... 64 1e-08 ref|XP_002892412.1| lactoylglutathione lyase family protein [Ara... 64 1e-08 ref|XP_002531367.1| catalytic, putative [Ricinus communis] gi|22... 64 2e-08 ref|NP_001238248.1| uncharacterized protein LOC100527071 [Glycin... 61 1e-07 >ref|XP_003606649.1| hypothetical protein MTR_4g063500 [Medicago truncatula] gi|355507704|gb|AES88846.1| hypothetical protein MTR_4g063500 [Medicago truncatula] Length = 227 Score = 65.9 bits (159), Expect = 5e-09 Identities = 34/46 (73%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -1 Query: 397 HR*GELESGPTTIAFTPIHQHETDDLIGEVR-ERSKKRRNQLEVCF 263 HR GELESG TTIAFTPIHQHETDDL G V RS K R +EVCF Sbjct: 41 HRWGELESGHTTIAFTPIHQHETDDLTGVVHTTRSNKERPPVEVCF 86 >ref|NP_973779.1| dessication-induced 1VOC-like protein [Arabidopsis thaliana] gi|8439904|gb|AAF75090.1|AC007583_26 ESTs gb|Z27026 and gb|29860 come from this gene [Arabidopsis thaliana] gi|12083304|gb|AAG48811.1|AF332448_1 putative receptor serine/threonine kinase [Arabidopsis thaliana] gi|26451584|dbj|BAC42889.1| unknown protein [Arabidopsis thaliana] gi|332190036|gb|AEE28157.1| dessication-induced 1VOC-like protein [Arabidopsis thaliana] Length = 137 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -1 Query: 397 HR*GELESGPTTIAFTPIHQHETDDLIGEVR-ERSKKRRNQLEVCF 263 HR GELESG TTIAFTP+HQHETDDL G+V+ +S + R +EVCF Sbjct: 42 HRWGELESGQTTIAFTPLHQHETDDLTGKVQATQSARERAPIEVCF 87 >ref|XP_002892412.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. lyrata] gi|297338254|gb|EFH68671.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. lyrata] Length = 137 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -1 Query: 397 HR*GELESGPTTIAFTPIHQHETDDLIGEVR-ERSKKRRNQLEVCF 263 HR GELESG TTIAFTP+HQHETDDL G+V+ +S + R +EVCF Sbjct: 42 HRWGELESGQTTIAFTPLHQHETDDLTGKVQATQSARERAPIEVCF 87 >ref|XP_002531367.1| catalytic, putative [Ricinus communis] gi|223529027|gb|EEF31015.1| catalytic, putative [Ricinus communis] Length = 144 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 397 HR*GELESGPTTIAFTPIHQHETDDLIGEVR-ERSKKRRNQLEVCFSNA 254 HR GELESG TTIAFTPIHQHETDDL G VR + R +EVCF+ A Sbjct: 43 HRWGELESGQTTIAFTPIHQHETDDLSGTVRTPHFGRERAPIEVCFAYA 91 >ref|NP_001238248.1| uncharacterized protein LOC100527071 [Glycine max] gi|255631490|gb|ACU16112.1| unknown [Glycine max] Length = 139 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/46 (67%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -1 Query: 397 HR*GELESGPTTIAFTPIHQHETDDLIGEVRE-RSKKRRNQLEVCF 263 HR GELE+G TTIAFTPIHQHETDDL G V S + R +EVCF Sbjct: 41 HRWGELETGNTTIAFTPIHQHETDDLTGAVHNPGSCRERPPMEVCF 86