BLASTX nr result
ID: Atractylodes22_contig00042507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042507 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272164.1| PREDICTED: uncharacterized protein LOC100258... 57 2e-06 >ref|XP_002272164.1| PREDICTED: uncharacterized protein LOC100258714 [Vitis vinifera] Length = 239 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/74 (40%), Positives = 47/74 (63%) Frame = +2 Query: 74 NVSGPYKSDPYAAQPLAAFIRRNLLPIIGMVICTGAIVFLMIVLIFPPLPRFRLDTFTLS 253 N + PY + PY++ P A F+RR L +I I G I+F++ +++ P LP F + + +LS Sbjct: 39 NAAHPYHAPPYSS-PRATFLRRFLAAMIAFFIIVGTIIFIVWLVLRPRLPYFSVASASLS 97 Query: 254 DFNVTATSLVSGNW 295 FNV+A+ L SG W Sbjct: 98 SFNVSASQL-SGEW 110