BLASTX nr result
ID: Atractylodes22_contig00042427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042427 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520467.1| UDP-glucuronosyltransferase, putative [Ricin... 87 1e-15 gb|AFJ52969.1| UDP-glycosyltransferase 1 [Linum usitatissimum] 84 1e-14 gb|AFJ52968.1| UDP-glycosyltransferase 1 [Linum usitatissimum] 84 2e-14 ref|XP_002520465.1| UDP-glucuronosyltransferase, putative [Ricin... 83 3e-14 ref|XP_002314141.1| predicted protein [Populus trichocarpa] gi|2... 82 3e-14 >ref|XP_002520467.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223540309|gb|EEF41880.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 453 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = -3 Query: 163 QGHINPMLQLGNILHSKGFSIIILHARFNSPNPTNYPHFNFLPIPDVLEDHSLS 2 QGHINPMLQLG IL+SKG SII+ H +FN PNP+N+P FNFL IPD L DH +S Sbjct: 19 QGHINPMLQLGGILYSKGLSIIVAHTKFNYPNPSNHPEFNFLSIPDGLSDHDIS 72 >gb|AFJ52969.1| UDP-glycosyltransferase 1 [Linum usitatissimum] Length = 452 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -3 Query: 163 QGHINPMLQLGNILHSKGFSIIILHARFNSPNPTNYPHFNFLPIPDVLEDHSLS 2 QGHINPMLQL ILHS+GFSI ILHA FNSP+P N+PHF F+ IPD L D +S Sbjct: 20 QGHINPMLQLATILHSRGFSISILHAHFNSPSPRNHPHFKFISIPDGLPDELVS 73 >gb|AFJ52968.1| UDP-glycosyltransferase 1 [Linum usitatissimum] Length = 451 Score = 83.6 bits (205), Expect = 2e-14 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = -3 Query: 163 QGHINPMLQLGNILHSKGFSIIILHARFNSPNPTNYPHFNFLPIPDVLEDHSLS 2 QGHINPMLQL ILHS+GFSI ILHA+FN+P+P N+PHF F+ IPD L D +S Sbjct: 20 QGHINPMLQLATILHSRGFSISILHAQFNAPSPRNHPHFRFISIPDSLPDELVS 73 >ref|XP_002520465.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223540307|gb|EEF41878.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 453 Score = 82.8 bits (203), Expect = 3e-14 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = -3 Query: 163 QGHINPMLQLGNILHSKGFSIIILHARFNSPNPTNYPHFNFLPIPDVLEDHSLS 2 QGHINPMLQLG ILHSKGFS+ I+H +FNSPNP+++P FLPIPD L D ++ Sbjct: 50 QGHINPMLQLGTILHSKGFSVTIIHTQFNSPNPSSHPELIFLPIPDDLLDQEIA 103 >ref|XP_002314141.1| predicted protein [Populus trichocarpa] gi|222850549|gb|EEE88096.1| predicted protein [Populus trichocarpa] Length = 461 Score = 82.4 bits (202), Expect = 3e-14 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = -3 Query: 163 QGHINPMLQLGNILHSKGFSIIILHARFNSPNPTNYPHFNFLPIPDVLEDHSLS 2 QGHINP+LQL +LHSKGFSI I+H +FNSP+P+NYP FNFL I D L DH ++ Sbjct: 20 QGHINPLLQLSAVLHSKGFSITIVHTQFNSPDPSNYPDFNFLFIQDGLSDHDIA 73