BLASTX nr result
ID: Atractylodes22_contig00042411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042411 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631260.1| PREDICTED: uncharacterized protein LOC100852... 56 3e-06 ref|XP_003519935.1| PREDICTED: uncharacterized protein LOC100776... 55 8e-06 >ref|XP_003631260.1| PREDICTED: uncharacterized protein LOC100852726 [Vitis vinifera] Length = 339 Score = 55.8 bits (133), Expect = 3e-06 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 3/71 (4%) Frame = -2 Query: 278 SFVKANAAGGKARQGTKA--KKPTVYEA-YLKSRGEHTEEERRRSYLPYRPELMGFFTNV 108 S K N+ GK G K+ + +E+ Y+K+R E RR+SYLPYR +L+GFFTNV Sbjct: 271 SVEKINSGDGKVGGGKVKGEKRVSAHESLYIKNRALR-EGGRRKSYLPYRQDLVGFFTNV 329 Query: 107 HGGLSKNVHPY 75 + GLS+NVHP+ Sbjct: 330 N-GLSRNVHPF 339 >ref|XP_003519935.1| PREDICTED: uncharacterized protein LOC100776669 [Glycine max] Length = 244 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/76 (40%), Positives = 41/76 (53%) Frame = -2 Query: 302 AKPATAAGSFVKANAAGGKARQGTKAKKPTVYEAYLKSRGEHTEEERRRSYLPYRPELMG 123 AKPA A S V K + T A + +E + E ++R+SYLPY+ +L G Sbjct: 172 AKPAEKASSVVVKKVEVKKGKTTTAAA--SAHEKHYVMSRARKESDKRKSYLPYKQDLFG 229 Query: 122 FFTNVHGGLSKNVHPY 75 FF N GLS+NVHPY Sbjct: 230 FFANA-SGLSRNVHPY 244