BLASTX nr result
ID: Atractylodes22_contig00042389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042389 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270485.1| PREDICTED: alpha-glucan water dikinase, chlo... 68 7e-10 ref|NP_001234405.1| glucan water dikinase [Solanum lycopersicum]... 67 1e-09 gb|ACC93586.1| starch-granule-bound R1 protein [Solanum tuberosum] 65 7e-09 gb|AAK11735.1| starch associated protein R1 [Solanum tuberosum] 64 2e-08 gb|AFH88388.1| alpha-glucan water dikinase [Solanum tuberosum] 64 2e-08 >ref|XP_002270485.1| PREDICTED: alpha-glucan water dikinase, chloroplastic [Vitis vinifera] gi|297739096|emb|CBI28585.3| unnamed protein product [Vitis vinifera] Length = 1470 Score = 68.2 bits (165), Expect = 7e-10 Identities = 34/45 (75%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 133 SFVVMPFVLFSGRKWIKNDGSDFYVEF-VGPKMAIKDAGDGKGTA 2 SFV MPFVL S WIKN GSDFY+EF VGPK KDAGDGKGTA Sbjct: 519 SFVGMPFVLLSQGNWIKNGGSDFYIEFRVGPKQVKKDAGDGKGTA 563 Score = 54.3 bits (129), Expect(2) = 3e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 245 KSGSNLFLKVEIDDPSIQALEFLIVDEAKNKW 150 KSGS LK+E+DDP+IQA+EFLIVDE +NKW Sbjct: 166 KSGSKSILKIEVDDPAIQAIEFLIVDETQNKW 197 Score = 21.6 bits (44), Expect(2) = 3e-06 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 94 KWIKNDGSDFYVE 56 KW KN+G +F V+ Sbjct: 196 KWFKNNGENFSVK 208 >ref|NP_001234405.1| glucan water dikinase [Solanum lycopersicum] gi|196122257|gb|ACG69788.1| glucan water dikinase [Solanum lycopersicum] Length = 1465 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 133 SFVVMPFVLFSGRKWIKNDGSDFYVEF-VGPKMAIKDAGDGKGTA 2 +FV MPFVLFSG KWIKN GSDFYV+F K+A+K AGDG GTA Sbjct: 516 NFVGMPFVLFSGEKWIKNQGSDFYVDFSAASKLALKAAGDGSGTA 560 >gb|ACC93586.1| starch-granule-bound R1 protein [Solanum tuberosum] Length = 1463 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 133 SFVVMPFVLFSGRKWIKNDGSDFYVEF-VGPKMAIKDAGDGKGTA 2 +FV MPFVL SG KWIKN GSDFYV+F K+A+K AGDG GTA Sbjct: 514 NFVGMPFVLLSGEKWIKNQGSDFYVDFSAASKLALKAAGDGSGTA 558 >gb|AAK11735.1| starch associated protein R1 [Solanum tuberosum] Length = 1464 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 133 SFVVMPFVLFSGRKWIKNDGSDFYVEF-VGPKMAIKDAGDGKGTA 2 +FV MPFVL SG KWIKN GSDFYV+F K A+K AGDG GTA Sbjct: 515 NFVGMPFVLLSGEKWIKNQGSDFYVDFSAASKSALKAAGDGSGTA 559 >gb|AFH88388.1| alpha-glucan water dikinase [Solanum tuberosum] Length = 1464 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 133 SFVVMPFVLFSGRKWIKNDGSDFYVEF-VGPKMAIKDAGDGKGTA 2 +FV MPFVL SG KWIKN GSDFYV+F K A+K AGDG GTA Sbjct: 515 NFVGMPFVLLSGEKWIKNQGSDFYVDFSAASKSALKAAGDGSGTA 559