BLASTX nr result
ID: Atractylodes22_contig00042173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042173 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277884.2| PREDICTED: uncharacterized protein LOC100248... 60 1e-07 emb|CBI32817.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_003624906.1| Transcription factor bZIP37 [Medicago trunca... 60 2e-07 ref|XP_003554104.1| PREDICTED: uncharacterized protein LOC100127... 59 3e-07 ref|XP_003521109.1| PREDICTED: uncharacterized protein LOC100101... 59 3e-07 >ref|XP_002277884.2| PREDICTED: uncharacterized protein LOC100248184 [Vitis vinifera] Length = 768 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 DVEGMMGPKSFSRIFVVVLLDSVKYVTYSCMLP 101 D +GMMGPKS SRIFVVVLLDSVKYVTYSC LP Sbjct: 725 DGDGMMGPKSLSRIFVVVLLDSVKYVTYSCGLP 757 >emb|CBI32817.3| unnamed protein product [Vitis vinifera] Length = 680 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 DVEGMMGPKSFSRIFVVVLLDSVKYVTYSCMLP 101 D +GMMGPKS SRIFVVVLLDSVKYVTYSC LP Sbjct: 637 DGDGMMGPKSLSRIFVVVLLDSVKYVTYSCGLP 669 >ref|XP_003624906.1| Transcription factor bZIP37 [Medicago truncatula] gi|124361217|gb|ABN09189.1| cAMP response element binding (CREB) protein [Medicago truncatula] gi|355499921|gb|AES81124.1| Transcription factor bZIP37 [Medicago truncatula] Length = 765 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 DVEGMMGPKSFSRIFVVVLLDSVKYVTYSCMLP 101 DV+GMM PKS SRIFVVVL+DSVKYVTYSC LP Sbjct: 723 DVDGMMAPKSLSRIFVVVLIDSVKYVTYSCGLP 755 >ref|XP_003554104.1| PREDICTED: uncharacterized protein LOC100127362 [Glycine max] Length = 728 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 DVEGMMGPKSFSRIFVVVLLDSVKYVTYSCMLP 101 DV+GMM PKS SRIFVVVL+DSVKYVTYSC LP Sbjct: 685 DVDGMMRPKSLSRIFVVVLIDSVKYVTYSCGLP 717 >ref|XP_003521109.1| PREDICTED: uncharacterized protein LOC100101871 [Glycine max] Length = 775 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 DVEGMMGPKSFSRIFVVVLLDSVKYVTYSCMLP 101 DV+GMM PKS SRIFVVVL+DSVKYVTYSC LP Sbjct: 732 DVDGMMRPKSLSRIFVVVLIDSVKYVTYSCGLP 764