BLASTX nr result
ID: Atractylodes22_contig00042079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00042079 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147341.1| PREDICTED: NAD-dependent protein deacetylase... 79 5e-13 ref|XP_002306275.1| histone deacetylase [Populus trichocarpa] gi... 78 9e-13 ref|XP_002516335.1| chromatin regulatory protein sir2, putative ... 76 3e-12 gb|ACU23889.1| unknown [Glycine max] 76 3e-12 gb|AEI70250.1| auxin response factor 10 [Solanum lycopersicum] 75 4e-12 >ref|XP_004147341.1| PREDICTED: NAD-dependent protein deacetylase SRT2-like [Cucumis sativus] Length = 387 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 124 FFGDNVPKDRANTAMEAAKGCDAFLVLGSSVMTMSAFRLVR 246 FFGDNVPKDRAN AMEAAK CDAFLVLGSSVMTMSA+RLVR Sbjct: 297 FFGDNVPKDRANKAMEAAKNCDAFLVLGSSVMTMSAYRLVR 337 >ref|XP_002306275.1| histone deacetylase [Populus trichocarpa] gi|222855724|gb|EEE93271.1| histone deacetylase [Populus trichocarpa] Length = 352 Score = 77.8 bits (190), Expect = 9e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 124 FFGDNVPKDRANTAMEAAKGCDAFLVLGSSVMTMSAFRLVR 246 FFGDNVPKDRA+ AM+AAKGCDAFLVLGSS+MTMSAFRLVR Sbjct: 263 FFGDNVPKDRADKAMDAAKGCDAFLVLGSSLMTMSAFRLVR 303 >ref|XP_002516335.1| chromatin regulatory protein sir2, putative [Ricinus communis] gi|223544565|gb|EEF46082.1| chromatin regulatory protein sir2, putative [Ricinus communis] Length = 365 Score = 76.3 bits (186), Expect = 3e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 124 FFGDNVPKDRANTAMEAAKGCDAFLVLGSSVMTMSAFRLVR 246 FFGDNVPKDRA+ AMEAA+GCDAFL LGSS+MTMSAFRLVR Sbjct: 276 FFGDNVPKDRADKAMEAARGCDAFLALGSSLMTMSAFRLVR 316 >gb|ACU23889.1| unknown [Glycine max] Length = 122 Score = 75.9 bits (185), Expect = 3e-12 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +1 Query: 88 LSPQILSGGCLFFFGDNVPKDRANTAMEAAKGCDAFLVLGSSVMTMSAFRLVR 246 +S LS L FFGDNVPKDRA+ AMEA++ CDAFLVLGSS+MTMSAFRL+R Sbjct: 21 ISAMELSNLMLSFFGDNVPKDRADMAMEASRRCDAFLVLGSSLMTMSAFRLIR 73 >gb|AEI70250.1| auxin response factor 10 [Solanum lycopersicum] Length = 699 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +3 Query: 243 QVAWDKTDLLQKMKHVSPWLVELVSNIPSIHERPFLPPKKKLRILDD 383 QVAWD+ DLLQ +KHVSPWLVELVSN+P IH PF PP+KKLR+ D Sbjct: 356 QVAWDEPDLLQNVKHVSPWLVELVSNMPVIHLSPFSPPRKKLRLPPD 402