BLASTX nr result
ID: Atractylodes22_contig00041694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041694 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269448.1| PREDICTED: uncharacterized WD repeat-contain... 87 1e-15 ref|XP_002308129.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|XP_002534411.1| WD-repeat protein, putative [Ricinus communi... 79 5e-13 ref|XP_003532316.1| PREDICTED: WD repeat-containing protein 36-l... 77 2e-12 dbj|BAD37438.1| putative beta transducin [Oryza sativa Japonica ... 76 3e-12 >ref|XP_002269448.1| PREDICTED: uncharacterized WD repeat-containing protein C1672.07 isoform 1 [Vitis vinifera] gi|297740341|emb|CBI30523.3| unnamed protein product [Vitis vinifera] Length = 905 Score = 87.4 bits (215), Expect = 1e-15 Identities = 44/69 (63%), Positives = 56/69 (81%) Frame = -1 Query: 231 LFILELVLEYLIHKISCRNNYKFIQAVTRLFLKIHDETIRRQSKLQVKAQKLLEVNLLYD 52 LF +EL+L+Y IH+ISCRNN++FIQAV RLFLKIH ETIRRQS LQ KA+KLLEV Sbjct: 824 LFPIELLLDYFIHEISCRNNFEFIQAVIRLFLKIHGETIRRQSNLQDKAKKLLEVQCAVW 883 Query: 51 RSLMECFRA 25 +S+ + F++ Sbjct: 884 QSVDKLFQS 892 >ref|XP_002308129.1| predicted protein [Populus trichocarpa] gi|222854105|gb|EEE91652.1| predicted protein [Populus trichocarpa] Length = 910 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = -1 Query: 222 LELVLEYLIHKISCRNNYKFIQAVTRLFLKIHDETIRRQSKLQVKAQKLLE 70 +EL+L+Y IH+ISCRNN++F+QAVTRLFLKIH ETIR SKLQ KA+KLL+ Sbjct: 832 IELLLDYFIHEISCRNNFEFVQAVTRLFLKIHGETIRCNSKLQDKARKLLD 882 >ref|XP_002534411.1| WD-repeat protein, putative [Ricinus communis] gi|223525346|gb|EEF27972.1| WD-repeat protein, putative [Ricinus communis] Length = 906 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = -1 Query: 222 LELVLEYLIHKISCRNNYKFIQAVTRLFLKIHDETIRRQSKLQVKAQKLLE 70 +EL+L+Y IH+ISCRNN++F+QA+ RLFLKIH ETIR QSKLQ KA+KLL+ Sbjct: 828 IELLLDYFIHEISCRNNFEFVQAIIRLFLKIHGETIRCQSKLQDKARKLLD 878 >ref|XP_003532316.1| PREDICTED: WD repeat-containing protein 36-like [Glycine max] Length = 907 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/69 (52%), Positives = 54/69 (78%) Frame = -1 Query: 231 LFILELVLEYLIHKISCRNNYKFIQAVTRLFLKIHDETIRRQSKLQVKAQKLLEVNLLYD 52 L +E +L+Y IH++SCRNN++F+QAV RLFLKIH ETIR+QS LQ KA+KLL++ + Sbjct: 826 LVSIEWLLDYFIHELSCRNNFEFLQAVIRLFLKIHGETIRQQSCLQEKARKLLDIQCMVW 885 Query: 51 RSLMECFRA 25 + + + F++ Sbjct: 886 QRVDKLFQS 894 >dbj|BAD37438.1| putative beta transducin [Oryza sativa Japonica Group] Length = 832 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/66 (53%), Positives = 51/66 (77%) Frame = -1 Query: 222 LELVLEYLIHKISCRNNYKFIQAVTRLFLKIHDETIRRQSKLQVKAQKLLEVNLLYDRSL 43 + L+L+Y IH++SCRNN++F+QAV +LFLKIH ETIRR S LQ K +KLL+V L + + Sbjct: 754 ISLLLDYFIHELSCRNNFEFVQAVLKLFLKIHGETIRRHSMLQDKVKKLLDVQSLVWQKI 813 Query: 42 MECFRA 25 + F++ Sbjct: 814 DKVFQS 819