BLASTX nr result
ID: Atractylodes22_contig00041605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041605 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267590.1| PREDICTED: uncharacterized protein LOC100243... 64 1e-08 ref|XP_002529729.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002267590.1| PREDICTED: uncharacterized protein LOC100243390 [Vitis vinifera] Length = 301 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -3 Query: 207 STSEAQKTEKSVNTSNRRRRKSWTSLKEIAESSDNDNSRRFIKLTVPF 64 S S + T+KSV+TSN+RRRKSWTSL+EIAE+S+ N+R LT+PF Sbjct: 252 SNSASADTQKSVSTSNKRRRKSWTSLREIAETSEQGNTRNIANLTIPF 299 >ref|XP_002529729.1| conserved hypothetical protein [Ricinus communis] gi|223530793|gb|EEF32658.1| conserved hypothetical protein [Ricinus communis] Length = 290 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = -3 Query: 207 STSEAQKTEKSVNTSNRRRRKSWTSLKEIAESSDNDNSRRFIKLTVPF 64 S ++ +E++VN S++R+RKSWTSLKEIAES ++D++R LT+PF Sbjct: 241 SNKASKDSERTVNASSKRKRKSWTSLKEIAESKEHDSTRNVTNLTIPF 288