BLASTX nr result
ID: Atractylodes22_contig00041601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041601 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75186.1| hypothetical protein VITISV_001913 [Vitis vinifera] 55 8e-06 >emb|CAN75186.1| hypothetical protein VITISV_001913 [Vitis vinifera] Length = 746 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%) Frame = -1 Query: 375 GMKAFKLFDLESKSFFCSRDVIFHEGIFPCHDGT-LEVACDPFPDAVLP 232 G+K ++L+D+ +K F S+D IFHE IFP H T L+ DPFP+ VLP Sbjct: 281 GIKGYRLYDVVTKQIFISQDAIFHEEIFPFHTATPLDKLIDPFPNLVLP 329