BLASTX nr result
ID: Atractylodes22_contig00041436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041436 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285497.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER i... 55 5e-06 ref|XP_002303894.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002285497.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform 1 [Vitis vinifera] gi|225435476|ref|XP_002285498.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform 2 [Vitis vinifera] gi|297746341|emb|CBI16397.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 55.5 bits (132), Expect = 5e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -1 Query: 301 YHAGCGSQWLSINKACPICYKEVLVHIPK 215 YHA CG++WLSINKACPICY EV+ +PK Sbjct: 221 YHAACGTRWLSINKACPICYTEVIGEVPK 249 >ref|XP_002303894.1| predicted protein [Populus trichocarpa] gi|222841326|gb|EEE78873.1| predicted protein [Populus trichocarpa] Length = 228 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -1 Query: 301 YHAGCGSQWLSINKACPICYKEVLVHIPKH 212 YHAGCG++WLSINKACPICY EV KH Sbjct: 199 YHAGCGTRWLSINKACPICYSEVFGDASKH 228