BLASTX nr result
ID: Atractylodes22_contig00041401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041401 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002961312.1| hypothetical protein SELMODRAFT_70578 [Selag... 134 6e-30 ref|XP_002983246.1| hypothetical protein SELMODRAFT_43579 [Selag... 134 6e-30 ref|XP_002325647.1| predicted protein [Populus trichocarpa] gi|2... 134 8e-30 ref|XP_002518281.1| nucleic acid binding protein, putative [Rici... 134 1e-29 ref|XP_004170318.1| PREDICTED: uncharacterized LOC101207419 [Cuc... 133 1e-29 >ref|XP_002961312.1| hypothetical protein SELMODRAFT_70578 [Selaginella moellendorffii] gi|300172251|gb|EFJ38851.1| hypothetical protein SELMODRAFT_70578 [Selaginella moellendorffii] Length = 351 Score = 134 bits (338), Expect = 6e-30 Identities = 62/69 (89%), Positives = 67/69 (97%) Frame = +1 Query: 1 EQVDRLVGKDHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASLNG 180 E+VDRL+G+DHLFKRSIIL+KAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASL G Sbjct: 142 EEVDRLIGRDHLFKRSIILVKAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASLRG 201 Query: 181 PVQVLYRFL 207 P+ VLYRFL Sbjct: 202 PLGVLYRFL 210 >ref|XP_002983246.1| hypothetical protein SELMODRAFT_43579 [Selaginella moellendorffii] gi|300148931|gb|EFJ15588.1| hypothetical protein SELMODRAFT_43579 [Selaginella moellendorffii] Length = 351 Score = 134 bits (338), Expect = 6e-30 Identities = 62/69 (89%), Positives = 67/69 (97%) Frame = +1 Query: 1 EQVDRLVGKDHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASLNG 180 E+VDRL+G+DHLFKRSIIL+KAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASL G Sbjct: 142 EEVDRLIGRDHLFKRSIILVKAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASLRG 201 Query: 181 PVQVLYRFL 207 P+ VLYRFL Sbjct: 202 PLGVLYRFL 210 >ref|XP_002325647.1| predicted protein [Populus trichocarpa] gi|222862522|gb|EEF00029.1| predicted protein [Populus trichocarpa] Length = 533 Score = 134 bits (337), Expect = 8e-30 Identities = 62/69 (89%), Positives = 67/69 (97%) Frame = +1 Query: 1 EQVDRLVGKDHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASLNG 180 E+VDRLVGK+HLFKRSIILIKAWCYYESRILGAHHGLISTYALETL+LYIFH+FH SLNG Sbjct: 192 EEVDRLVGKNHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLILYIFHLFHCSLNG 251 Query: 181 PVQVLYRFL 207 P+ VLYRFL Sbjct: 252 PLAVLYRFL 260 >ref|XP_002518281.1| nucleic acid binding protein, putative [Ricinus communis] gi|223542501|gb|EEF44041.1| nucleic acid binding protein, putative [Ricinus communis] Length = 821 Score = 134 bits (336), Expect = 1e-29 Identities = 61/69 (88%), Positives = 67/69 (97%) Frame = +1 Query: 1 EQVDRLVGKDHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASLNG 180 EQVD+L+GK HLFKRSIILIKAWCYYESRILGAHHGLISTYALETL+LYIFH+FH+SLNG Sbjct: 185 EQVDQLIGKSHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLILYIFHLFHSSLNG 244 Query: 181 PVQVLYRFL 207 P+ VLYRFL Sbjct: 245 PLMVLYRFL 253 >ref|XP_004170318.1| PREDICTED: uncharacterized LOC101207419 [Cucumis sativus] Length = 816 Score = 133 bits (335), Expect = 1e-29 Identities = 60/69 (86%), Positives = 68/69 (98%) Frame = +1 Query: 1 EQVDRLVGKDHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLVLYIFHVFHASLNG 180 E++DR +GKDHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLVLYIFH+FH++LNG Sbjct: 96 EKIDRRIGKDHLFKRSIILIKAWCYYESRILGAHHGLISTYALETLVLYIFHLFHSALNG 155 Query: 181 PVQVLYRFL 207 P+QVLY+FL Sbjct: 156 PLQVLYKFL 164